(data stored in SCRATCH zone)

EMBL: CU928166.PE299

CU928166.PE299       Location/Qualifiers
FT   CDS_pept        584739..585329
FT                   /locus_tag="KLTH0B07238g"
FT                   /old_locus_tag="KLTH-ORF14954"
FT                   /product="KLTH0B07238p"
FT                   /note="highly similar to uniprot|Q12328 Saccharomyces
FT                   cerevisiae YDL217C TIM22 Mitochondrial inner membrane
FT                   protein involved in import of proteins of the ADP/ATP
FT                   carrier (AAC) family"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07238g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21664"
FT                   /db_xref="GOA:C5DD03"
FT                   /db_xref="InterPro:IPR039175"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD03"
FT                   /protein_id="CAR21664.1"
FT                   /translation="MVYRGFGLEQVSPPPNKPFNEMTPEEQGEHGAQMMVNFMTSCPGK
FT                   TAISGVTGFALGGVFGLFMASMAYDTPLHTPTVPGESQLPSNVKHISDLPFKQQVKLQF
FT                   ADMGKRAYSSAKNFGYIGMIYSGVECVIESLRAKNDIYNGVTAGCLTGGGLAYKSGPSA
FT                   ALMGCAGFAAFSTAIDLYMRQENGTPPKNDFDE"
     atggtctatc gtggcttcgg ccttgagcaa gtgtctccgc ctcccaataa acccttcaat        60
     gaaatgacac cagaagaaca gggcgaacat ggagcacaga tgatggtaaa tttcatgact       120
     tcgtgtcctg gaaaaacagc tatcagcggt gtgactggtt tcgcacttgg tggtgtgttt       180
     ggtcttttca tggcttctat ggcttatgat acgccacttc atactcctac tgtgcccggc       240
     gaatcgcagc ttccaagtaa tgttaaacac atatctgacc tgcctttcaa gcaacaagtc       300
     aagctacagt tcgcagatat gggaaaaaga gcctactcaa gtgccaaaaa ttttggttat       360
     attggtatga tctattctgg tgtcgagtgt gtaatcgagt cattgagagc caaaaacgat       420
     atttacaatg gagtgaccgc gggctgtctg actggtggcg gtttagcata caagagtggg       480
     ccatctgctg cccttatggg ctgcgcgggc ttcgcggcct tttcaactgc catcgatctt       540
     tacatgagac aggagaatgg cactcctcca aaaaatgatt ttgacgagta a                591
//

If you have problems or comments...

PBIL Back to PBIL home page