(data stored in ACNUC8465 zone)

EMBL: CU928166.PE3

CU928166.PE3         Location/Qualifiers
FT   CDS_pept        complement(7385..9055)
FT                   /locus_tag="KLTH0B00154g"
FT                   /old_locus_tag="KLTH-ORF15979"
FT                   /product="KLTH0B00154p"
FT                   /note="weakly similar to uniprot|P38090 Saccharomyces
FT                   cerevisiae YBR132C High affinity polyamine permease,
FT                   preferentially uses spermidine over putrescine; expression
FT                   is down-regulated by osmotic stress; plasma membrane
FT                   carnitine transporter, also functions as a low-affinity
FT                   amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B00154g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21367"
FT                   /db_xref="GOA:C5DC57"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC57"
FT                   /protein_id="CAR21367.1"
FT                   /translation="MSKKENFELAVTTLEEGETTTIHDVGAETIRSLEGQAPSLEERIA
FT                   RRKLFPRQVSMIGIGGAIGTALFVSIGTQIIHGGPGSLLIAFCLWSVVFIGLSQCMCVM
FT                   VTYLPVTGSFVHFTERFVDSSCGFSVGWTYFVCQAANVCFEITAVCLVVEFWTDKIPKA
FT                   ALISILIALFGSLNLFSVFIFGEGEFYLSIGKVILAIGLIFFTIVVMAGGNPQHKVLGF
FT                   KNWSNPGAFAEYISKGSAGKFHGFMSCLIFALYVFWGVDYLGNAASEAMNPRKVIPSSF
FT                   RKVFGRLIIFYIGGAICVGILVPFNDHNMIKAISEGAVGAGASPYVSAMKTLGIGVLPH
FT                   IVNVLILTSIISAGNSSLYSASRVLHRLALEGQAPKLFKITKRGVPIYCCVAVLLVCGL
FT                   AYLSVSNSTNNVLTWFLNVETAAMAIVYIFICISYLQFAKGCKAQNIDLKTLPYSSSFL
FT                   PYLGWHSLFWLVLMLFMNGYAVFLKDSWDLQSFIFSYFMIPFFIVLFAGHKLYKKTRFV
FT                   KPVEMDLFSGIAELAEEDAYWEENPPKMNLLDKAFGFIL"
     atgtcaaaga aggagaactt tgaactagcc gtcaccactc tcgaagaggg agaaacgaca        60
     acgatacatg acgttggggc tgaaacaatt cggtcgctcg aaggacaggc gccgtcatta       120
     gaagaaagaa ttgcgcgaag aaagcttttt ccccgccaag tttcaatgat tggaattggt       180
     ggtgctattg gaacggcgct ttttgtctca attggaacgc aaattattca tggcgggcca       240
     ggctcactct tgatagcatt ttgtttgtgg tcagttgtat ttattggcct ttcgcagtgc       300
     atgtgcgtca tggtgacgta tttgccagtt actggttctt ttgtgcactt cacagagaga       360
     ttcgttgaca gttcgtgtgg attttctgtg ggatggactt attttgtgtg ccaagcagca       420
     aatgtgtgct ttgaaataac agctgtatgt ctagtagtcg aattctggac agataaaata       480
     ccgaaagcag ctctgatctc aattctaatc gcgctgtttg gctcccttaa tctgttttcc       540
     gtatttattt ttggggaggg tgaattttac ttatcaattg gtaaggttat tttggcgatt       600
     gggcttattt tcttcaccat tgtcgttatg gcagggggta acccgcaaca taaagttctg       660
     ggattcaaga attggtccaa tccaggcgca tttgccgaat atatttccaa aggctcagcc       720
     ggaaaatttc acggttttat gtcttgtctg atcttcgcct tatacgtctt ctggggagtt       780
     gactacttag gaaacgcagc tagcgaagca atgaacccaa ggaaagtgat cccttcatct       840
     tttcggaaag ttttcggaag acttatcatt ttttacattg gtggcgcgat ttgcgttggc       900
     attcttgtcc ctttcaacga ccacaatatg attaaagcga taagtgaggg ggcagtgggg       960
     gctggggcct ctccatatgt ttctgcaatg aagactcttg gaataggcgt gttgcctcat      1020
     attgtcaacg ttctgatatt gacttctatt atctcagctg gaaattcatc tttgtactcg      1080
     gcttcaaggg ttttgcatcg actggcactg gagggtcaag ccccaaagct tttcaagata      1140
     acgaagagag gagtacctat ttattgctgt gttgctgttc tactggtttg tggattagcg      1200
     tatctctcag tttccaacag tacaaataac gttttaacat ggttcctgaa tgttgagaca      1260
     gcagcaatgg caattgttta catcttcatt tgcatctcgt atttgcagtt tgcaaaaggc      1320
     tgtaaagcac aaaacattga tctcaaaact ctgccttatt ccagttcctt cctgccctat      1380
     ttgggttggc actcactttt ctggctagtc cttatgttgt tcatgaacgg ttatgcagtg      1440
     tttctgaaag actcttggga cctccaaagt tttatttttt catatttcat gatcccgttc      1500
     ttcattgtgt tgttcgccgg tcacaaactc tacaagaaaa ccaggtttgt aaagccagtt      1560
     gaaatggatc tgttctctgg aattgcagaa ctcgcagaag aggacgcgta ctgggaagaa      1620
     aatcctccca aaatgaactt gctggacaag gcttttgggt ttattctata g               1671
//

If you have problems or comments...

PBIL Back to PBIL home page