(data stored in SCRATCH zone)

EMBL: CU928166.PE30

CU928166.PE30        Location/Qualifiers
FT   CDS_pept        81585..83456
FT                   /locus_tag="KLTH0B00946g"
FT                   /old_locus_tag="KLTH-ORF15885"
FT                   /product="KLTH0B00946p"
FT                   /note="similar to uniprot|P32368 Saccharomyces cerevisiae
FT                   YKL212W SAC1 Lipid phosphoinositide phosphatase of the ER
FT                   and Golgi involved in protein trafficking and secretion"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B00946g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21395"
FT                   /db_xref="GOA:C5DC84"
FT                   /db_xref="InterPro:IPR002013"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC84"
FT                   /protein_id="CAR21395.1"
FT                   /translation="MAGPLLYSHLGEKIVFKLATPSSEKDVVLSLGPSGQDISLESPEI
FT                   FPTRGKIVKSAALIGCIKLKLNSYAIFAHRVEEFGVLAGHRIFKVVEHTILPLNKGGQR
FT                   DKDEQQYLDLLEMQLSSATLFYSYTYDLTNSAQRNEKLDGSSWKTADTRFFWNHYVTHS
FT                   LRTLAEKCPAAGDFIQPMIFGYAHFIETALNNVPITIGLVTRRSRFRAGTRYFRRGIDS
FT                   DGNVANFNETEQFLLVKKPEGGNSEFFSFLQTRGSVPVYWGEINNLKYKPNLVLGENSS
FT                   LDATAKHFDQQKSLYGENYLVNLVNQKGHELPVKNAYESAVNALNDPMIHYVYFDFHHE
FT                   CRKMKWYRVKLLIDHLQKMGLDPEDTFHKIVSPDGKTVDVVREQKSVVRTNCMDCLDRT
FT                   NVVQSVLASWVLQHEFQIANVVPEGTLWELDLKLLAKFQNFWADNADAVSFSYSGTGAL
FT                   KTDFTRTGKRTRKGAFADFMNSVSRYYQNNLSDGPRQDSFDLFHGNFLPFENSFQSPFP
FT                   DRRPLSIQIVPTVICAAITVIAATVFFPKGHFFSTKNLSFFFVSSAIVILSLRFIFRNG
FT                   EQYVNWPKFNNLGFLTAVQTHNKERTFKGIRYVQSPKFSKPGELKRD"
     atggctggcc ctttacttta ctcccacttg ggtgaaaaga ttgttttcaa actagcgacg        60
     ccctctagcg agaaagatgt ggtcctttct ttgggtcctt caggtcagga tatttctttg       120
     gaaagccctg aaatcttccc tacgagaggc aaaatagtga aaagcgcagc gctgataggc       180
     tgcattaagc ttaagcttaa ctcctacgcg atttttgctc accgggtgga ggagtttgga       240
     gtgcttgctg ggcacagaat cttcaaggtc gtagagcaca ccattttacc tctaaacaag       300
     ggtggccaaa gagacaaaga tgaacagcag tacttggatc tgttggaaat gcagctttcg       360
     agtgctacct tattttattc ttacacatac gacctgacca actccgcgca gagaaacgaa       420
     aagctcgacg gaagctcgtg gaagactgct gacacccgtt tcttctggaa ccactatgtg       480
     acgcattcct tgcggacctt agctgaaaaa tgccctgcag ccggtgactt tattcagccc       540
     atgatatttg gctacgcgca ttttattgag acagcgctca acaatgtgcc gattaccatc       600
     ggcttggtca cgagaagaag caggtttaga gcgggaacaa gatactttcg ccgcggtatt       660
     gattccgatg gtaatgtggc caacttcaac gaaactgagc aatttctctt ggtcaaaaag       720
     cctgaaggag ggaactccga attcttttca tttttgcaga caagaggttc cgtgccagtc       780
     tactgggggg agattaacaa tttgaagtac aagcccaacc ttgttcttgg ggaaaattct       840
     tcactggacg ccaccgccaa gcactttgac cagcaaaaaa gcctatatgg ggaaaactac       900
     ttggtgaacc ttgttaacca aaagggacac gagttgccag taaaaaatgc gtacgagtcc       960
     gctgtcaacg ctttgaacga tccaatgatc cattacgttt atttcgactt ccaccatgag      1020
     tgtcgcaaga tgaagtggta cagggtcaaa ctgttaattg atcatttgca gaaaatgggc      1080
     ctagaccccg aggatacttt ccataaaatt gtgtctcctg acggcaaaac agtggatgtt      1140
     gttagggaac aaaagtcggt tgtgagaacc aactgtatgg actgtttaga taggactaac      1200
     gttgtgcaat ctgtgttagc aagttgggtt ttgcaacatg aatttcagat tgcaaacgtt      1260
     gttcctgaag gtactttgtg ggagctggat ttgaagcttc tggcaaagtt ccaaaacttc      1320
     tgggccgaca acgccgatgc tgttagtttc tcatactcag gaacaggcgc cctgaaaacc      1380
     gatttcacga gaaccggcaa gcgtacccgt aagggcgcat tcgctgactt tatgaattca      1440
     gtatcgcgtt actaccagaa caacttaagc gatggacctc gtcaggatag ctttgattta      1500
     tttcacggaa actttttacc atttgagaac agtttccaat ctcccttccc cgacagaaga      1560
     cctctttcga tccaaattgt gcctacagta atctgtgctg cgatcacggt tattgcagcc      1620
     actgtatttt tccccaaggg ccacttcttt agcaccaaga acctttcatt tttctttgtc      1680
     tcgagcgcta tcgtgatttt gtctctgaga tttatcttta gaaatggcga acaatacgtc      1740
     aactggccca agttcaacaa tctaggattc ttgacggcgg tgcaaactca caacaaggag      1800
     cgcaccttta aaggtataag atacgtgcaa agccctaaat tctccaaacc tggcgagctg      1860
     aagagagact ag                                                          1872
//

If you have problems or comments...

PBIL Back to PBIL home page