(data stored in ACNUC8465 zone)

EMBL: CU928166.PE300

CU928166.PE300       Location/Qualifiers
FT   CDS_pept        complement(585375..586334)
FT                   /locus_tag="KLTH0B07260g"
FT                   /old_locus_tag="KLTH-ORF14953"
FT                   /product="KLTH0B07260p"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07260g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21665"
FT                   /db_xref="GOA:C5DD04"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD04"
FT                   /protein_id="CAR21665.1"
FT                   /translation="MSPPGINQSNLPSREYRIASESRIARINELYNRSQRQQKHRDSII
FT                   SDNSTSVPYIQDEDDCQPLAYLAPNRVRRAPVAPPDSETIKPAPVKNPFRPKPTEERPF
FT                   SEDDVERELQFTPKLMSRRSIVSSRTPSHGTPLRREGPEDIVPDTPVQLPIWFSKQVVP
FT                   DFNNTNRAARRREAFKELKQKLGKPLPLGYLSDFQDEASRSTKKNVEERRKRMLSSKGR
FT                   DISWHDTRSLSDESSGIHSPHTSASSGDFIAGELSATSTDDGFHQNISEGLRTNSEKLD
FT                   QIMVLLETRKKAASKRECLAWIFCIIVLIALNLYLSNL"
     atgagtcccc ccggcataaa ccagtccaat cttccatctc gagaataccg aattgctagc        60
     gaatctcgaa ttgcaagaat aaatgagtta tacaacagaa gccaaagaca gcagaaacac       120
     agagactcta taatatcaga caactcaaca tctgtaccct atatacagga tgaagacgac       180
     tgtcaaccat tggcatatct ggcgccgaac agagtacggc gcgcgcctgt ggctcctcca       240
     gattccgaga caataaaacc tgcacctgtg aaaaacccat tccgcccaaa accaaccgaa       300
     gagagaccct tttctgaaga cgacgtggag agggagcttc aatttactcc aaagctgatg       360
     tcaagaagga gtatcgtgtc ttccagaact ccgagccacg gcacacctct gcggagggaa       420
     ggccccgagg acatagtacc cgacacgccc gtacaattgc ccatatggtt ttccaaacag       480
     gtagttccag atttcaataa cacaaaccga gccgctagaa ggcgggaagc gttcaaagaa       540
     ctgaagcaaa agcttggaaa gccgcttcca ttaggctacc taagtgactt tcaagatgag       600
     gcttcgcgat ctaccaagaa aaatgtagag gagcgacgaa aacgtatgct ctctagcaaa       660
     gggcgtgaca tatcctggca tgataccagg tcactatctg acgaaagctc aggcattcac       720
     agcccccata caagcgcatc atctggagac tttatcgcag gcgaactcag tgcaactagt       780
     accgatgacg gcttccacca aaacataagt gaaggcctca ggacaaacag cgagaaactc       840
     gaccaaatta tggttctctt ggaaacaagg aaaaaagctg cttctaaacg agaatgcttg       900
     gcttggatct tttgtattat agttcttatc gcactcaatt tatatctgag taatttgtaa       960
//

If you have problems or comments...

PBIL Back to PBIL home page