(data stored in ACNUC8465 zone)

EMBL: CU928166.PE308

CU928166.PE308       Location/Qualifiers
FT   CDS_pept        600260..603043
FT                   /locus_tag="KLTH0B07436g"
FT                   /old_locus_tag="KLTH-ORF14930"
FT                   /product="KLTH0B07436p"
FT                   /note="some similarities with uniprot|P32797 Saccharomyces
FT                   cerevisiae YDL220C CDC13 Single stranded DNA- binding
FT                   protein found at TG1-3 telomere G-tails regulates telomere
FT                   replication through recruitment of specific sub- complexes
FT                   but the essential function is telomere capping"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07436g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21673"
FT                   /db_xref="GOA:C5DD12"
FT                   /db_xref="InterPro:IPR011564"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR031749"
FT                   /db_xref="InterPro:IPR041028"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD12"
FT                   /protein_id="CAR21673.1"
FT                   /translation="MNSNLPSGLKYICDPLELKGFFSEGEVLRQDIEFVSVLTSIDFNP
FT                   KSRCLFQFSNFRPGESVSPDYTCKITCNNVETLNLTKLTLSLVSQQFDLDFPDLNDAEG
FT                   FYMKDIHLEKLCFVCCKGTFVTCDNKGGIFLQGLRIIDIHSSLFDPTKRDERSSISETV
FT                   RVIFDNLVKLNDNSKAQFKFVKLQNYDTAMRKYIQSRQESMLSLKEKNPLFGLLKPRAD
FT                   HDSQNDFDSQLPDPDSNLDNAIFYGHRIPSESLDSQTPNLVSSEIIEEGQSPSVAGAAG
FT                   TPAALSGSNKPSSYQGSGSLSISQISPPRETEYVRLSRDFETSAIESNKRSAVVTSDQE
FT                   IRDDSSLDDDILEFSLSTHSVDKNELSQTSRGSQPTSKRQRIQMLGNISQKDPNSYMFH
FT                   ASLDEPLIISGVVFGLRINDAASSPSIALYIHAGSLQNESVSANLYPYKNCTEVLAYAS
FT                   DSIELNSKLFPAENSAEMLEALRWYVEDKKVELKVKKSSILLADGYFTFAWTLVSVKTA
FT                   GDAPKLSTSQTSHTPRSSQIVGSSQEASQDSLDPLKTFGEISISGNEVEFIRTFALLVS
FT                   AKTFGSKMHKFVFTDFTSHPKNKLSAFDSFLGSYTNRLPQDMAFPFVIYNDHFREFTTR
FT                   LQRHTGYNFNQLYSGNDNNLSNRGIVCRLSLKVKLYSGGIDGIIRRCEPIVVTKRLPKD
FT                   EERHITEFYDRAIREIPQIVLLNNFDSYKTFFPIAMFRGLVVLDTSDAQNQHRTPPSSQ
FT                   PALGALQPLPQRPPPKLHIELEHFTVNRHMEIPVLYGLDATDSSHLFELRAKVVAAIRT
FT                   GELLAFYVTNDWISQDMLDPTRVLRVEIPGRSNMDYFFGTYASQETRPDLAARDAQLGT
FT                   MIGETFTFRLVTFAVPVSPSRFLRTWCPVECTIQELSYELAARRGQAAARVKLEDS"
     atgaactcta accttcccag cggattgaaa tacatatgcg accctcttga attgaaaggt        60
     tttttttcag aaggggaggt gcttagacaa gacattgagt ttgtctctgt tttgaccagt       120
     atagacttca acccaaagtc taggtgttta ttccaattca gcaatttcag gcctggcgaa       180
     agcgtatctc ctgattacac ttgtaaaata acatgcaaca atgtggagac cttgaacctc       240
     acgaagctaa ctctctcgct tgtatcgcag cagttcgatc tagatttccc agatttgaat       300
     gatgccgaag gtttctatat gaaagatata cacctagaga agctttgttt cgtgtgctgt       360
     aaagggactt ttgttacatg cgacaacaaa ggcggtattt ttctgcaggg cttgcgcatc       420
     attgatatac actcttcact gttcgacccc acaaaacgag atgagaggtc atcaatcagc       480
     gaaactgtgc gagttatatt cgacaatctt gtaaaactta acgataactc caaggcccag       540
     ttcaaattcg tcaaacttca gaactacgat accgctatga gaaaatacat ccaatctaga       600
     caagaaagca tgctatcgct aaaagaaaaa aatcctctat ttggactctt gaagccccga       660
     gctgatcatg attcacaaaa tgattttgat tcacagctgc ccgaccctga ctccaaccta       720
     gataacgcga ttttttatgg tcatcgtata ccaagtgaaa gccttgattc gcaaactcca       780
     aacctagttt caagtgagat aatcgaagaa ggacagagcc catctgttgc tggagcagcc       840
     ggtactccag cagctctatc aggctcaaac aaaccatcat cttatcaagg atccggttcg       900
     ctatccattt cacagataag ccctccaaga gagacagagt acgttcgctt aagccgagat       960
     tttgaaacca gtgcgattga atcgaacaag cgctcagcag ttgtcacttc tgaccaagaa      1020
     attcgagatg attcttctct tgatgacgat attctggaat tttcgctcag cacacattct      1080
     gtggacaaga acgaactttc acaaacctcg aggggtagtc agccaacttc caagcggcag      1140
     agaatacaga tgttaggaaa cattagtcaa aaagatccaa attcttatat gtttcatgcc      1200
     tcgttagacg aacctttgat tataagtggc gtagtctttg ggcttcgtat aaatgacgct      1260
     gcgtcaagtc ctagtattgc gctctatatt cacgcaggca gccttcaaaa tgaaagtgtt      1320
     tccgcaaatc tttatccgta caagaattgc accgaggtcc tggcatatgc aagcgatagc      1380
     attgagctaa actcgaagct ttttccagcc gagaattctg cagaaatgct tgaagcactg      1440
     cggtggtacg tcgaagataa aaaggttgag ctcaaagtca aaaagtcgtc catactcctg      1500
     gccgacgggt atttcacctt tgcgtggacc ctcgtttcag taaagactgc gggtgacgcc      1560
     ccgaaattga gcacatctca gacaagccat actccgcgat ccagtcagat tgtaggttca      1620
     agtcaggaag cctcgcaaga ctctctggat cccttgaaaa cctttggtga aatctccata      1680
     tcaggcaacg aggttgaatt catcagaacg tttgctctcc tcgtgagcgc aaagacattt      1740
     ggctccaaaa tgcacaagtt cgttttcact gacttcacgt cacaccccaa gaataagctg      1800
     tccgcatttg attctttcct aggatcttac acgaatcgcc tgccccaaga catggcgttc      1860
     cctttcgtga tatacaatga ccatttccgc gagtttacca ctcgactgca aaggcacacg      1920
     ggatacaatt tcaatcagct ttacagcggg aacgataaca acctctcgaa ccgagggatc      1980
     gtgtgcaggt tgtcgttaaa ggtcaaactc tactccggtg gcatcgacgg aattatcaga      2040
     aggtgcgagc cgatcgtggt aacgaaacgt ctgccaaaag atgaggaaag gcacatcacc      2100
     gaattctacg accgggcgat ccgcgagatc ccccagattg tgcttcttaa caacttcgac      2160
     agctacaaaa ctttttttcc catcgcgatg ttccgaggtc ttgtcgtact cgacaccagc      2220
     gacgcccaga accagcatcg cacgccgccg tcgtcacagc cggccctggg cgctctccag      2280
     cctctgcccc agaggccacc tccaaagctc cacattgagc ttgagcattt cactgtcaac      2340
     cgccacatgg aaataccggt tctgtacggc ttagacgcca ctgacagctc tcatctcttc      2400
     gagctcaggg ccaaagtcgt ggcggctatt cgcacgggcg aactgttggc cttctatgtc      2460
     actaacgact ggatttcaca ggacatgctg gatccaacgc gagtgctgcg tgttgagata      2520
     cccggccgct ccaacatgga ctactttttt gggacttacg ctagccaaga aacgcgccca      2580
     gacctcgcgg cacgtgacgc tcaactcggg accatgatcg gcgaaacgtt cacgttccgc      2640
     ctggttactt ttgctgttcc tgtgagcccc agcagatttc tacgcacctg gtgtcctgta      2700
     gaatgcacga tccaagaact aagttacgaa ctggcagctc gacggggtca agccgctgct      2760
     agggtcaagc ttgaagattc ctag                                             2784
//

If you have problems or comments...

PBIL Back to PBIL home page