(data stored in ACNUC8465 zone)

EMBL: CU928166.PE309

CU928166.PE309       Location/Qualifiers
FT   CDS_pept        603685..604638
FT                   /locus_tag="KLTH0B07480g"
FT                   /old_locus_tag="KLTH-ORF14926"
FT                   /product="KLTH0B07480p"
FT                   /note="similar to uniprot|Q07651 Saccharomyces cerevisiae
FT                   YDL222C FMP45 The authentic non-tagged protein was
FT                   localized to the mitochondria cell cortex protein not
FT                   required for growth on nonfermentable carbon sources
FT                   required for viability in stationary phase"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07480g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21674"
FT                   /db_xref="GOA:C5DD13"
FT                   /db_xref="InterPro:IPR009571"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD13"
FT                   /protein_id="CAR21674.1"
FT                   /translation="MDRKGFFNNSLSRLNSKSNLASNNQRSENMRFKQSVTFVFLVLLL
FT                   GAGLLSFLAILGGARNTGVLRNLYWLEANTSGFGNAPATTRWYNYEWCGYEGGSAQDCS
FT                   SRRPAQPFSPRDNFGASDAMPATFVNNRKTYYYLSRVAWAMLLVGLVFIVMAIVPLLAT
FT                   VFAASTWVASLSTVWLWSALFFVTLAACLYTGCYVKARNAFADNGRRAKLGSKNFAFIW
FT                   TSVALLLICALWSTITTAVFGINKVRSNRRDSHGYDSYEGDKATTMDTYGDSDHPASSP
FT                   TKFKYFKRIRRYQAPAAPPATMATNYDEENIPAAPR"
     atggatcgta aagggttctt caataattca ctaagcagac taaattcgaa gagtaattta        60
     gcaagcaaca atcaaagatc agaaaatatg cgttttaaac agtctgtaac ttttgttttc       120
     ttggttctgc tactgggtgc agggctgctt tcatttttag cgattttggg aggggcgcgg       180
     aacacgggtg tactgcggaa cctctactgg ctcgaagcga atacttcggg cttcggcaat       240
     gctccggcga cgaccagatg gtataattac gagtggtgtg ggtacgaggg tggcagcgcg       300
     caggactgct cgtcgaggcg gccggcgcag cctttctcgc cccgcgataa ctttggagcg       360
     agtgacgcga tgccagcgac atttgttaac aaccgcaaaa cgtactacta tctgtcgcgc       420
     gttgcgtggg cgatgctgct ggtggggctt gttttcattg tgatggcaat tgtaccgctt       480
     ttggcgactg tttttgcagc gtcgacttgg gtggcgtcct tgtctacagt ttggctgtgg       540
     tcagcgctat tcttcgtgac gctcgcggca tgcctctaca caggctgcta cgtcaaagcg       600
     cgcaacgcgt ttgcggacaa tggccggcgc gcgaagctgg ggtcgaaaaa ctttgccttc       660
     atatggacta gcgtggcgct cctgctgata tgtgctttgt ggtcgacaat cacgaccgca       720
     gtgtttggaa tcaacaaagt gcgcagtaac aggagggaca gtcatggtta tgattcgtat       780
     gaaggagaca aagccacgac catggacacg tatggcgact cagatcatcc ggcgagttcc       840
     ccaacgaaat tcaaatattt caagaggata cgccgctatc aagcgcctgc ggcccctcca       900
     gctacaatgg ccactaatta tgatgaagaa aatatcccgg ccgcccctcg ttag             954
//

If you have problems or comments...

PBIL Back to PBIL home page