(data stored in SCRATCH zone)

EMBL: CU928166.PE316

CU928166.PE316       Location/Qualifiers
FT   CDS_pept        618664..621033
FT                   /locus_tag="KLTH0B07634g"
FT                   /old_locus_tag="KLTH-ORF14883"
FT                   /product="KLTH0B07634p"
FT                   /note="similar to uniprot|P40164 Saccharomyces cerevisiae
FT                   YNL201C PSY2 Nuclear protein of unknown function deletion
FT                   results in sensitivity to anticancer drugs oxaliplatin and
FT                   cisplatin but not mitomycin C deletion is synthetically
FT                   lethal with a chitin synthase (CHS1) null mutant"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07634g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21681"
FT                   /db_xref="InterPro:IPR006887"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD20"
FT                   /protein_id="CAR21681.1"
FT                   /translation="MNGVRQDELRETESKRVKVYILEQNEWKDTGTGFCIGKVDKEERQ
FT                   AEQNAPPEDALAAYLVVNDEEAPEKTLLWSKLEGNIEYQRQEETLIVWKDLSGQDIALS
FT                   FEESTGCDALCDFIIKIQKSSENNISLVAVRSNDDGMGSVHEIITGPVNLPCNDAEQDE
FT                   KQLMEALKILNENTAFEYLRSETMEFVLKSNYVATLIKLFEKAEAGHKLRELLLLSNIL
FT                   KTLTLYNQRELLEQMVGDEYIMGVVGILEYDTEFPTSKANHREYLLHSGPHFKEVVPLN
FT                   SDDMKRIIKKTYRLQFFKDVVLVRFLDEHSFNIISDIILDLQTCIINFIQDETFLPKLI
FT                   ALYTAASPDTPIETKRDGIRMLHQCVQITKNLEHSEKSRFFKALVRAGLFKIFDFAFGQ
FT                   ETDSGIRILATDMVISIIEHDILLINSVQNELINQPEGLDQEQQHSHKQPAENGNCTVS
FT                   SDVSLLAILSKILLTDKSLGLKEQVVQALNTLLHPEGCMGMDPDYNDSGGVDMMMNFND
FT                   ARSNGMNEENLIDNMNFQMTDYFNNFYTQVAPQLFAPLITNSLSTPDDDVLLIYLVKLI
FT                   NFVSTEHNRRLSREFIMENNILKNIAKLLDPQRMLQLRLTVVRCLKSIVCLNDEFYHRY
FT                   LISENLYAPVMDLLRENLHEDNLANSSILDFFKIVSSQCMQALELKASDKRNFIMLNKH
FT                   LVKNYRDILLEVDYVPFTKDMIRMYDEGEGQLRESVTESTSMVYAKEGKRTFSETLETT
FT                   KVSTSEETTTFKKAMEKITSAPPQSFIKEDVLGTEF"
     atgaatggcg tcaggcagga tgagctgcga gaaacggagt cgaagcgcgt gaaggtttac        60
     atattggaac agaacgagtg gaaggacaca ggtaccggat tctgcatcgg gaaggtggac       120
     aaggaggagc ggcaagcgga gcagaacgcg cccccggaag acgcgttagc cgcttactta       180
     gtggtcaacg acgaagaggc gccggagaag acgctgctgt ggtcgaagct ggaagggaac       240
     attgagtacc agcggcagga ggagacgctg attgtgtgga aggacttgtc gggtcaggac       300
     atcgcgctca gcttcgagga aagcacaggc tgcgacgcgt tgtgcgattt catcatcaaa       360
     atccaaaaat cttctgagaa caacatctcg ctggtcgcgg tgcgctctaa tgacgacggc       420
     atgggctctg ttcatgaaat catcaccggg cccgtgaacc tgccctgcaa cgatgcggag       480
     caggacgaga agcagctgat ggaggcgctc aagatcctca acgaaaacac ggctttcgag       540
     tacctgcggt ctgagaccat ggagttcgtg ctgaagtcga actacgtcgc gaccctgatc       600
     aagctgtttg agaaggccga ggctggccac aagctgcggg agctgctgct cctgagcaac       660
     attctcaaga ctctgacgct gtacaaccag cgcgagcttc tcgaacagat ggtcggggac       720
     gagtacatca tgggggtagt gggcattctc gagtacgaca cggagttccc caccagtaaa       780
     gcaaaccacc gagagtactt gctgcactcg gggccccact tcaaggaggt ggtgccgctg       840
     aacagcgacg atatgaaaag aattatcaag aagacctacc ggctgcagtt tttcaaggac       900
     gtcgtactag tgcgtttctt ggacgagcac agcttcaaca ttatatccga catcattctg       960
     gatttacaaa cctgcattat caatttcata caggatgaaa cgtttctccc gaaactgatc      1020
     gctctataca cggcagcctc cccagacacc cctatcgaga ctaagaggga cggcatacgc      1080
     atgcttcacc agtgcgtcca gataacaaag aatctggagc attccgaaaa gtccaggttt      1140
     ttcaaggctc tggtgagagc aggtttgttc aagatcttcg attttgcatt cggtcaagag      1200
     acagacagcg gaatcagaat cctggccacg gacatggtaa taagcattat agagcacgac      1260
     atcctgctga tcaacagcgt acagaatgag ctcattaacc agccagaagg cttagaccaa      1320
     gagcagcagc attctcataa gcagcccgct gaaaatggca actgcactgt atcgtcagac      1380
     gtatctctgc ttgcgatctt gtccaagatt cttttgacag acaaaagctt gggactaaag      1440
     gagcaggtgg tacaggcttt aaacacgcta cttcacccgg agggttgcat gggcatggat      1500
     ccagactata atgactccgg aggcgttgac atgatgatga actttaatga cgcacgttct      1560
     aatggaatga acgaggaaaa ccttattgac aacatgaatt tccagatgac agactacttc      1620
     aacaactttt acacccaagt cgccccacag ctttttgcac ccctcataac caattccctg      1680
     agtactcctg atgatgacgt tcttttgatt tacttggtaa agctgatcaa tttcgtcagt      1740
     acggaacaca accgccggct ttcccgcgaa ttcataatgg agaataacat tttgaaaaac      1800
     atagccaagc tcttggatcc tcaacgcatg ctccagctcc gcttaactgt ggttcgatgc      1860
     ttgaaaagca tagtgtgttt gaatgacgag ttttaccaca gataccttat ttcagagaat      1920
     ctttacgccc cagtaatgga cttgctgcgc gaaaatcttc atgaagacaa cttggccaac      1980
     tcgagcattc tggatttctt caaaatcgtc tcttctcagt gtatgcaggc tctggagctc      2040
     aaggcgtctg ataagagaaa cttcatcatg ctcaacaagc atttggtgaa aaattaccgt      2100
     gacattctgc tcgaagtcga ctacgtgccc ttcaccaagg atatgattag aatgtatgac      2160
     gagggagaag ggcagctccg cgagagcgtc acggagtcta ctagcatggt ttacgcaaaa      2220
     gagggcaaac ggacattttc agaaaccttg gagactacca aagtcagcac aagcgaggag      2280
     accacgacgt tcaaaaaagc catggagaaa atcacctcag ctccaccaca aagtttcata      2340
     aaggaagatg tactgggtac tgagttttaa                                       2370
//

If you have problems or comments...

PBIL Back to PBIL home page