(data stored in ACNUC8465 zone)

EMBL: CU928166.PE320

CU928166.PE320       Location/Qualifiers
FT   CDS_pept        complement(625231..626517)
FT                   /locus_tag="KLTH0B07722g"
FT                   /old_locus_tag="KLTH-ORF14867"
FT                   /product="KLTH0B07722p"
FT                   /note="similar to uniprot|P40160 Saccharomyces cerevisiae
FT                   YNL207W RIO2 Protein required for cell viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07722g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21685"
FT                   /db_xref="GOA:C5DD24"
FT                   /db_xref="InterPro:IPR000687"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015285"
FT                   /db_xref="InterPro:IPR030484"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD24"
FT                   /protein_id="CAR21685.1"
FT                   /translation="MKLDISNMRYMTAEDFRVLQAVEQGSRNHEVVPTQMIHQISGMRS
FT                   QSGTNRSIGDLAKLKLVSRMRNIKYDGFRLTYNGFDYLGLRAMLSRDTIYSVGNVIGVG
FT                   KESDVYRVSAKDGSARVLKIHRLGRTSFTTVKNNRDYLKRNQSGSWMFLSRLAANKEYQ
FT                   FMSLLHSKGFTVPEPFDNSRHMILMELIDGYPMRNMRLHKNLPKLYSDLMLFIVKLANH
FT                   GLIHCDFNEFNIMIKNSVTGPEDNGFIVIDFPQCISIQHQDAEFFFKRDVDCIRRFFKK
FT                   KLKFEPRVDESMLDVDGFGDGYKYPYPVFERDVKRCDNLDELVQASGFSKKHPGDRRWE
FT                   EAAEQMRKEVSEQDVVEGDPNDLLEAEESSEGYSEGYSDDEYYSSEEEEESEEGEDSLE
FT                   EENERIVEALSSGVANLKMDKLGNYVLED"
     atgaagcttg atattagcaa tatgcgctat atgaccgcgg aggacttccg cgtcctgcag        60
     gccgtggagc aggggtcaag aaaccacgag gtcgtcccca cacagatgat ccaccaaatc       120
     tccgggatga ggtcccagtc gggaacgaat cggtcgattg gcgacctcgc aaagctgaaa       180
     cttgtttcga ggatgcgtaa cataaaatac gacgggttcc gtctcaccta caatggcttt       240
     gattacctcg gcctcagagc tatgctcagc cgcgacacga tctactcggt gggaaatgtg       300
     attggtgtcg gtaaggagtc tgatgtgtac cgcgttagcg ccaaggacgg tagtgcacgc       360
     gtgctgaaga tccaccgtct gggtcgcacg tccttcacca ctgtgaaaaa caacagagac       420
     tacttgaagc gtaaccagag cggaagctgg atgtttcttt cccgcttagc agccaacaag       480
     gagtaccagt ttatgagcct gctgcatagc aagggtttca ctgttcccga gccttttgac       540
     aactcccgcc acatgatcct tatggagttg atcgacggat atcccatgcg taacatgcga       600
     ttgcataaaa acctccctaa gctgtacagc gacctgatgc tatttatcgt caaactcgcc       660
     aatcacggcc taatccactg tgactttaac gaattcaaca tcatgataaa gaattctgtt       720
     accggtcccg aggacaatgg cttcattgtt atcgacttcc cacaatgtat ttcgatccag       780
     catcaagatg cggagttttt cttcaagaga gacgtggact gtatccgcag attctttaaa       840
     aagaagctga agttcgagcc tcgcgtggac gaatctatgc tagatgttga cggattcggt       900
     gacggttaca aataccctta ccctgtattc gaaagagatg tgaaaagatg tgataatctg       960
     gacgagctag ttcaagcgtc cggtttcagt aaaaaacatc ctggtgacag aaggtgggaa      1020
     gaggccgccg aacagatgcg aaaggaggtg agtgaacaag atgttgtgga gggagatccc      1080
     aacgaccttt tggaggccga agaaagctca gagggttact ctgagggtta ctctgacgac      1140
     gagtactata gctccgagga agaggaggaa tccgaagaag gtgaagactc cttagaagaa      1200
     gagaatgaac ggattgttga ggctctgtcg agtggtgtgg ctaacctcaa gatggacaag      1260
     ctcgggaact acgtgcttga agattaa                                          1287
//

If you have problems or comments...

PBIL Back to PBIL home page