(data stored in ACNUC8465 zone)

EMBL: CU928166.PE321

CU928166.PE321       Location/Qualifiers
FT   CDS_pept        complement(628224..630065)
FT                   /locus_tag="KLTH0B07744g"
FT                   /old_locus_tag="KLTH-ORF14860"
FT                   /product="KLTH0B07744p"
FT                   /note="highly similar to uniprot|P40150 Saccharomyces
FT                   cerevisiae YNL209W SSB2 Ribosome-associated molecular
FT                   chaperone heat shock protein of HSP70 family proposed to be
FT                   involved in the folding of newly synthesized polypeptide
FT                   chains homolog of SSB1"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07744g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21686"
FT                   /db_xref="GOA:C5DD25"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD25"
FT                   /protein_id="CAR21686.1"
FT                   /translation="MAEGVFAGAVGIDLGTTYSCVATYESSVEIIANEQGNRVTPSFVA
FT                   FTPEERLIGDAAKNQAALNPRNTVFDAKRLIGRRFDDESVQSDMKTWPFKVIDVNDAPM
FT                   IEVEYLGETKTFSPQEISSMVLTKMKETAEAKIGKKVEKAVITVPAYFNDAQRQATKDA
FT                   GAISGLNVLRIINEPTAAAIAYGLGAGKSDKERHVLIFDLGGGTFDVSLLHIAGGVYTV
FT                   KSTSGNTHLGGQDFDTNMLDHFKAEFKKKTGLDISNDARALRRLRTAAERAKRTLSSVT
FT                   QTTIEVDSLFEGEDFETSITRARFEDINAALFKSTLEPVEQVLKDAKIAKSQIDEVVLV
FT                   GGSTRIPKVQKLLSDFFEGKQLEKSINPDEAVAYGAAVQGAILTGQSTSEDTKDLLLLD
FT                   VAPLSLGVAMQGNVFAPVVPRNTTVPTIKRRTFTTVADHQTTVQFPVYQGERVNCSENT
FT                   LLGEFDLKGIPPLPAGEPVLEAIFEVDANGILKVTAVEKSTGKSANITISNAVGRLSSD
FT                   EIEKMVNQAEEFKAADEAFAKKHEARQRLESYVSSVEQTVTDPVLSSKMKRGAKSKIES
FT                   ALSDAMAALEIEDSSADDLRKAEVGLKRVVTKAMSTR"
     atggctgaag gtgttttcgc aggtgctgtc ggtatcgact tgggtaccac ctactcttgt        60
     gttgcgactt acgagtcgtc ggtcgagatt atcgccaacg aacaaggtaa cagagttacc       120
     ccatcgttcg ttgctttcac tcccgaggag agactaattg gtgacgctgc caagaaccag       180
     gctgcgttga acccaagaaa caccgtcttc gacgctaagc gtttgatcgg tagaagattc       240
     gacgacgagt ccgtccagag cgacatgaag acctggcctt tcaaggtcat cgacgtcaac       300
     gacgccccaa tgatcgaggt cgagtacttg ggtgagacca agactttctc ccctcaggag       360
     atctcctcca tggtcttgac caagatgaag gagaccgccg aggccaagat cggtaagaag       420
     gtcgagaagg ccgtcatcac cgtcccagcc tactttaacg acgcccagag acaggctacc       480
     aaggacgccg gtgccatttc cggtttgaac gttctgcgta tcatcaacga gcctaccgcc       540
     gccgctatcg cttacggtct aggtgctggt aagtccgaca aggagagaca cgtcctgatt       600
     ttcgacttgg gtggtggtac tttcgatgtt tccttgctgc acatcgccgg cggtgtctac       660
     accgtcaagt ctacctccgg taacactcac ttgggtggcc aggacttcga caccaacatg       720
     ttggaccact tcaaggccga gttcaagaag aagaccggtt tggacatctc caacgacgcc       780
     agagccttga gaagattgag aactgccgcc gagagagcta agagaactct gtcttccgtc       840
     acccagacca ccatcgaggt cgactctctg ttcgagggtg aggacttcga gacctctatc       900
     accagagcta gattcgagga catcaacgcc gccttgttca agtctacctt ggagccagtc       960
     gagcaagtcc taaaggacgc caagatcgcc aagtcccaga tcgacgaggt cgtcttggtc      1020
     ggtggttcca ccagaatccc aaaggtccag aagttgttgt ccgacttctt cgagggtaag      1080
     cagttggaga aatctatcaa cccagacgag gctgtcgcct acggtgccgc cgtccagggt      1140
     gctatcctga ccggtcagtc cacctctgag gacaccaagg acttgttgtt gttggatgtc      1200
     gctccattgt ccctgggtgt tgccatgcag ggcaacgtct tcgccccagt cgtgccaaga      1260
     aacaccactg tcccaaccat caagagaaga actttcacta ccgtcgctga ccaccagacc      1320
     accgttcagt tcccagtcta ccagggtgag cgtgtcaact gtagcgagaa caccttgttg      1380
     ggtgagttcg acttgaaggg tatcccacct ttgccagctg gtgagccagt cttggaggct      1440
     atcttcgagg ttgacgccaa cggtatcttg aaggtcaccg ccgtcgagaa gtccaccggt      1500
     aagtccgcca acatcactat ctccaacgct gtcggcagac tgtcttccga cgagatcgag      1560
     aagatggtta accaggccga ggagttcaag gccgccgacg aggccttcgc caagaagcac      1620
     gaggccagac agagattgga gtcttacgtc tcctctgtcg agcagaccgt caccgaccca      1680
     gtcctgtctt ccaagatgaa gagaggtgcc aagtccaaga tcgagtccgc tttgtccgac      1740
     gccatggctg ctttggaaat cgaggactcc tctgccgatg acttgagaaa ggccgaggtc      1800
     ggcttgaaga gagtcgtcac caaggccatg tccactcgtt aa                         1842
//

If you have problems or comments...

PBIL Back to PBIL home page