(data stored in ACNUC8465 zone)

EMBL: CU928166.PE322

CU928166.PE322       Location/Qualifiers
FT   CDS_pept        complement(630469..631470)
FT                   /locus_tag="KLTH0B07766g"
FT                   /old_locus_tag="KLTH-ORF14852"
FT                   /product="KLTH0B07766p"
FT                   /note="some similarities with uniprot|P16523 Saccharomyces
FT                   cerevisiae YNL210W MER1 Protein with RNA- binding motifs
FT                   required for meiosis-specific mRNA splicing required for
FT                   chromosome pairing and meiotic recombination"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07766g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21687"
FT                   /db_xref="GOA:C5DD26"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD26"
FT                   /protein_id="CAR21687.1"
FT                   /translation="MDVCLEPPTVHQDQEAWQSYSLDQGEVGDPSTPRTAGSRAAAKGV
FT                   LKGPVSRDSNEKEASQGTVSRLEQVFRGARDSVSVRVACTVRADAPRARFLVSRLRVRS
FT                   FLEALALAGGGRERRLTGTLTITADSYHSATVECPLDVELLTSVVGDAPVCMLLPRELV
FT                   HVIRSGGLELRSQVRALSARAITLESIKSAPVFADLASLAAHSFYKCPHAPFCPIPARA
FT                   TPRCISATLVAPAACSRAPSEITTHTVRLNKPEITFLIGRQGARIEQLRLQSRAVIKIL
FT                   PIPARLSANQLANPACIEQCLSITGDIESVARAVCLVGALLETFRQAPRHVR"
     atggacgtct gtttagagcc gccaacggta caccaggatc aggaagcatg gcaatcctat        60
     tcactagacc aaggagaggt tggagatcct tcgacgccgc gcactgcggg ctcgcgcgcc       120
     gcggcaaagg gcgttcttaa aggccctgtt tcaagggact ctaacgaaaa ggaggcaagc       180
     caaggaaccg tgtcgcggct ggagcaggtt ttccgaggtg ctcgtgactc cgtgtcggta       240
     cgtgttgcgt gcacggtgcg cgcagacgcg cctcgtgcgc gctttctggt ttcgcggctc       300
     agagtccgga gtttcttgga agcgcttgcg ctcgctggcg gcggtcgcga gcgacgccta       360
     acgggcacgc tcacgattac cgcagactca taccactctg caactgtgga gtgtccgctg       420
     gacgtcgagc tgctgacctc ggtggtcggc gatgcgccgg tgtgcatgct tctgccgcga       480
     gagcttgtac acgtgatccg ctcgggcggg ctggagctgc ggtcgcaggt gcgcgcgctt       540
     agcgcgcgcg ctattacgct cgaaagcatt aaatccgcgc ctgtttttgc cgatctcgcg       600
     agcctggccg cgcacagctt ctacaagtgc ccgcacgcgc cgttctgccc catccctgcg       660
     cgagcgacgc cgcggtgcat ctctgccacg cttgttgccc cagccgcatg ctcgcgggcc       720
     ccgtcagaga tcaccaccca cacggttcgc ctgaacaagc ccgagatcac cttcctcatt       780
     ggccgccagg gcgcccgaat cgaacagcta aggctccagt cacgtgccgt catcaaaatc       840
     ctacccatcc cggcccgcct ctccgccaac cagctcgcca accccgcctg tatcgagcag       900
     tgtctctcta tcaccggcga cattgagtcc gtggcccgcg ccgtgtgtct tgtgggcgcg       960
     ctactcgaga ccttccgcca agcgccgcgg cacgtgcgct ga                         1002
//

If you have problems or comments...

PBIL Back to PBIL home page