(data stored in ACNUC8465 zone)

EMBL: CU928166.PE323

CU928166.PE323       Location/Qualifiers
FT   CDS_pept        complement(631704..632702)
FT                   /locus_tag="KLTH0B07788g"
FT                   /old_locus_tag="KLTH-ORF14847"
FT                   /product="KLTH0B07788p"
FT                   /note="similar to uniprot|P25044 Saccharomyces cerevisiae
FT                   YDL230W PTP1 Phosphotyrosine-specific protein phosphatase
FT                   that dephosphorylates a broad range of substrates in vivo
FT                   including Fpr3p localized to the cytoplasm and the
FT                   mitochondria"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07788g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21688"
FT                   /db_xref="GOA:C5DD27"
FT                   /db_xref="InterPro:IPR000242"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR003595"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR016277"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD27"
FT                   /protein_id="CAR21688.1"
FT                   /translation="MASETVPWYLKQSAQELVSKFRFIQHQEDLRLRDATLNPAKSRWS
FT                   LGSSVDESNDDRNRYVNIMPYERNRVKLRTQAGNDYINASYVKVQVPGQSVRPGHYIAT
FT                   QGPTQNSWPQFWQMCYQQCTGSDIVIAMVTPLVEGGRQKCFEYWPHDAAAPLKIPRTQS
FT                   SSCSASGPESSCTTFDVDLEVHFQCSERENDYTLSTLELAPADPAFPKKTVHHFYFDRW
FT                   RDMSKPDEIVPILKLSRHAHSLNSSENPMVVHCSAGVGRTGTFITLDHLFHDTLDFTAA
FT                   QPVQDYSHDLVEQIVLQLRTQRLKMVQMVDQFLFIYHAARYVFDLARTRDQ"
     atggcgtcag agacagtacc gtggtacttg aaacagagcg cacaggagct cgtaagcaag        60
     ttccgcttca ttcagcatca agaagactta cggctgaggg acgcgacatt aaacccagct       120
     aagtcgcgat ggagtttggg ttcttctgta gatgagtcga acgacgacag aaaccggtac       180
     gtgaacatta tgccgtacga gcgcaaccgc gtgaaacttc ggacgcaggc tggcaacgac       240
     tacattaatg cgtcttacgt caaggtgcag gtgcctgggc agtcggtgcg gccgggccac       300
     tacatcgcga ctcaagggcc cacgcagaac tcgtggcctc agttctggca gatgtgctac       360
     cagcagtgca ccggaagcga catagttata gccatggtga cgccgctggt ggagggcggg       420
     cgccaaaagt gcttcgagta ctggcctcac gacgcggccg ctccgctgaa gataccaagg       480
     acacagagct ccagctgctc cgcgtcgggg cccgagtcga gctgcacgac gttcgacgtc       540
     gacctggagg tgcacttcca atgcagcgag cgcgagaacg actacacgct ctcgacgctc       600
     gaactcgcgc cagcagaccc ggctttccca aagaaaaccg ttcaccactt ctacttcgac       660
     cgctggagag acatgtcgaa gcctgacgag atagttccga tcctcaaact ctcgcgtcat       720
     gcgcatagcc tgaactcgag cgaaaaccct atggtggttc actgttctgc gggcgtcggc       780
     cgcacgggca ccttcatcac gctcgaccat ctttttcacg acaccctcga tttcacggcc       840
     gcgcagccgg tgcaggacta cagccacgat cttgttgagc agatcgtcct gcagctgcgc       900
     acccagcgtc tcaagatggt ccagatggtg gaccagttcc tcttcatcta ccacgctgcc       960
     cgatacgtct tcgacctagc ccgtacacgt gaccagtga                              999
//

If you have problems or comments...

PBIL Back to PBIL home page