(data stored in ACNUC8465 zone)

EMBL: CU928166.PE324

CU928166.PE324       Location/Qualifiers
FT   CDS_pept        632854..636033
FT                   /locus_tag="KLTH0B07810g"
FT                   /old_locus_tag="KLTH-ORF14843"
FT                   /product="KLTH0B07810p"
FT                   /note="similar to uniprot|Q07660 Saccharomyces cerevisiae
FT                   YDL231C BRE4 Zinc finger protein containing five
FT                   transmembrane domains null mutant exhibits strongly
FT                   fragmented vacuoles and sensitivity to brefeldin A a drug
FT                   which is known to affect intracellular transport"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07810g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21689"
FT                   /db_xref="GOA:C5DD28"
FT                   /db_xref="InterPro:IPR018823"
FT                   /db_xref="InterPro:IPR023244"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD28"
FT                   /protein_id="CAR21689.1"
FT                   /translation="MVDSKVSKGSYKHKSFLSLKELGQSSKNKGPPSSRTSLSQLKLNL
FT                   LADGKHWEILEDYGLEELRDGFFDPIFTRHENVVPSEEDSDSAVSKTAGRLTVASWVAH
FT                   NLEGLKQSWQPMLKFWLAFFIAVCICLIHPSGSWLGHRFRYFMPVAVLIHHPARNIGVQ
FT                   LEITLWSITGAAFGMGWSALAWYISVATRPTANHQGGILFASMFLAVFLSTWLRSSKQR
FT                   LLYFSLSYGIAICFLHTVDLVNAKSMLDWKLYWDFGIPYLFGLLISMVVCAAVFPHSGQ
FT                   SEIISRFSTSINNIKQLLVTFLELDECGNTDRHHLLQKEIGTSIDFDVSEGMREFLNQL
FT                   TITRISEESLLSFRNSITIAAAPLRSMPTDHKLLTKLELQDFYEAYQDKHKEGQTVDKS
FT                   HGDTHMPVSGNATPLPKSNNFVGLGGHTNSELFTSMLRSTFSSSLLSLLVEMIALLETI
FT                   ESGLDNFANGKLFDNENLGIEEKLKSHISKLIRRIYNIDVCYKEFTKSNLFCKELLSDS
FT                   QAIDSFLFLRYLRQSAKNLIPVATCVVEMSANLRWRVELPHYPWRRALNRLPHRCSIDQ
FT                   GAKSLLHYFETKSDVDDLFEQLYNSYTSRHKVSAEGPEKGKIRATVRAIDHKDFSLHTT
FT                   SHPLRYKLWLLSTEITSYESRWALKIAIVMTFFALPAWLPQSNRWYQEYQCWWAPLSFL
FT                   LLSNRRHSGNWPSMGRRLASALLGIFWGWCSNQARHFGSPYVVATFAGLLCAVLSFNFF
FT                   ANNHTKSSFTGLLCFVVIALEPYSKRSSLNTAFIWKNTWVTGVALLCGILLSIPINWIL
FT                   WSFTARHELRISISSLLAHISQSYQSVTDRYLYRDADDAPTELTLKYSSIREVRLSQSL
FT                   IAVKRLLQKAREEPNYIFEFKADLYEQLLDACEYLLEKMVEARLSGQHFEVWDQDSNSE
FT                   ISRALLSLRRDSVASVIFIFYMLSNCFLSKNRIPMYLPNVIMSRKKLYDFISKFESNFA
FT                   SRSSTAVSNSESSDSEIKEHDTNPSSDDYEKSHWTQIHGMAFARAFTDIAEVVQKLANL
FT                   SREILGEEDCC"
     atggttgatt ctaaggtgtc gaagggctca tacaagcaca agtccttctt atcgctgaag        60
     gagctgggcc agagttcgaa gaacaagggc cctccatctt caaggacgtc gctatcgcag       120
     cttaagctta atctactggc ggacggtaag cattgggaga tcttagagga ctatgggttg       180
     gaagaactga gagatgggtt tttcgatccg atcttcacaa ggcacgagaa tgtcgtgccg       240
     tccgaagaag acagcgatag cgccgtgtca aagacggccg ggcggttgac ggtcgcaagc       300
     tgggtggcac acaacttgga ggggcttaag caatcttggc aacctatgct gaagttctgg       360
     cttgccttct tcattgctgt gtgcatctgc ctgatccacc cgtcggggtc gtggctgggt       420
     caccgcttca gatacttcat gccggttgcg gtgttgatac accacccagc acgcaacatc       480
     ggagtgcagc tggaaattac gctttggtcg atcaccggcg cagcttttgg gatgggatgg       540
     tccgccctag cgtggtacat ttccgttgct acaaggccaa ctgccaacca ccaaggcggt       600
     atccttttcg cgagcatgtt cttggcagtg tttttgtcga cgtggctgcg ctcctctaag       660
     caaaggctgt tgtatttctc gctatcttac ggcattgcca tatgcttcct gcacacggtc       720
     gacttggtca acgccaaatc tatgctcgac tggaaactgt attgggattt tggaataccg       780
     tatctgtttg gactgcttat ctcaatggtc gtgtgcgccg cggtattccc ccactctggg       840
     cagtccgaga tcatatctcg attttcgacg tccatcaata acatcaaaca acttctggtc       900
     acatttctag agcttgacga gtgcggaaac actgatagac atcacttgct acagaaggaa       960
     atcggcacca gcattgactt cgatgtgtct gagggtatgc gagaattttt gaatcaatta      1020
     accataacaa gaattagtga ggagtcactc ctaagctttc gtaattccat taccatcgcc      1080
     gctgccccac tgagatcaat gcccacagac cataagcttc tcacgaagct cgagcttcag      1140
     gatttctacg aagcctatca agataaacac aaagaaggtc aaaccgtcga taaatctcac      1200
     ggtgatacac acatgccagt ttcaggaaat gcaactccac tccccaaatc taataacttt      1260
     gttggccttg gcggtcatac aaatagcgaa ctatttacca gcatgctaag gtctacgttc      1320
     tcgagtagcc tgttgtcctt actagttgag atgattgcgc ttttagaaac gatagaaagc      1380
     gggcttgata acttcgccaa tggtaagctt ttcgataatg aaaatcttgg tattgaggaa      1440
     aaactgaaaa gccacatcag caagttgatt cgcaggatat acaacatcga cgtttgttac      1500
     aaagagttta ctaaatcgaa ccttttttgc aaagagcttc tctcagactc gcaagccatt      1560
     gactcttttc tgttcttgag atacttgaga caaagtgcca aaaaccttat ccccgttgcc      1620
     acatgcgtcg ttgaaatgag cgcgaatctg cgttggcgtg tcgaacttcc ccattacccc      1680
     tggcgccgcg cattaaacag actgccgcac cgctgcagta ttgaccaagg agcaaaatct      1740
     ctcttgcact acttcgaaac gaagtcggat gtcgacgatc tgttcgagca actttataac      1800
     agctacacct caagacacaa agtaagcgcc gaaggaccag aaaaaggtaa aatacgcgct      1860
     acagtcaggg ctatcgacca taaggacttt agcttgcata ctaccagcca tcccttgaga      1920
     tacaagctct ggctactgag caccgaaatt acttcttatg aaagtagatg ggcactgaaa      1980
     attgcaatcg tgatgacatt ctttgctttg ccagcatggc ttcctcagtc caatcggtgg      2040
     taccaagaat atcagtgttg gtgggccccg ctatcgtttc tcctcctgtc taatcgtcgg      2100
     cacagtggga attggccatc tatgggcagg cggctcgctt ctgccttgtt aggaattttc      2160
     tggggatggt gttctaacca agcgcgtcac tttggcagtc cctatgtcgt tgcaacattt      2220
     gcagggttac tgtgtgcagt cctttccttc aacttttttg ccaacaatca caccaaatct      2280
     agttttaccg gtctcttgtg ctttgttgtg attgcactgg aaccatacag caaacgtagc      2340
     tctttgaaca cagcgtttat ctggaaaaac acatgggtca caggagtagc gcttttgtgc      2400
     ggaatattac tttcaattcc tattaactgg attctttggt cgtttacggc gcgtcatgaa      2460
     ctcagaatct ctatttcctc actgctcgca cacataagtc agtcgtacca aagcgtgact      2520
     gatcgctacc tctacagaga tgccgatgat gccccaaccg agttgacact aaaatattct      2580
     agtataagag aagtgcgcct ttcccaaagc ttaatcgctg tgaaaaggtt gcttcaaaaa      2640
     gcacgcgaag agcccaacta tatttttgaa ttcaaggctg atctttacga gcaactctta      2700
     gacgcatgtg aatatctgct ggaaaaaatg gtggaggcga ggctttctgg tcaacatttc      2760
     gaggtttggg accaagacag caacagcgaa atctcaagag cactgttatc tctgagacgc      2820
     gatagtgtcg catctgttat cttcattttt tacatgttgt caaactgttt tctttcaaag      2880
     aatagaattc cgatgtacct acccaatgtt atcatgtcaa ggaagaagct ctatgatttc      2940
     atttctaaat ttgaatcaaa tttcgcgtcc aggtcttcaa ctgctgtgag caattctgag      3000
     tcctcggatt ccgaaataaa ggaacatgac accaatcctt cgtctgacga ctatgagaaa      3060
     tcccactgga cccaaatcca tggtatggca tttgcgcgcg ctttcaccga tattgcggaa      3120
     gttgtgcaga aacttgccaa cctgagtcgt gaaattttgg gtgaggagga ttgctgttaa      3180
//

If you have problems or comments...

PBIL Back to PBIL home page