(data stored in SCRATCH zone)

EMBL: CU928166.PE328

CU928166.PE328       Location/Qualifiers
FT   CDS_pept        complement(640619..641242)
FT                   /locus_tag="KLTH0B07898g"
FT                   /old_locus_tag="KLTH-ORF14833"
FT                   /product="KLTH0B07898p"
FT                   /note="similar to uniprot|P40155 Saccharomyces cerevisiae
FT                   YNL214W PEX17 Peroxisomal membrane protein component of the
FT                   peroxisomal translocation machinery required for peroxisome
FT                   biogenesis binds Pex14p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07898g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21693"
FT                   /db_xref="GOA:C5DD32"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD32"
FT                   /protein_id="CAR21693.1"
FT                   /translation="MNHKGYSGIEWPSEATIRERAKKNNTVDFVQRVFYNAGVVVSLVY
FT                   VIIVSIIEPLLRSQFNQRLQLSADMLIRVRKFVSLLEQRLKSTSISAIGFNEKVDPESC
FT                   VSTIERCTQTEELLESSGVEEKATEWTKIIARLRYAREMLSRANEGKNDNNASGRITPL
FT                   KFQAQSLSAYISSLDTRDETFRNHKNSVQAIRDMKGWVINGRVR"
     atgaaccaca aaggttacag cggcattgag tggccaagcg aagccaccat acgcgagagg        60
     gccaagaaga acaacactgt ggattttgta cagagagttt tctacaatgc aggcgttgta       120
     gtgtcgttgg tttacgttat catagtctca attattgagc ctcttcttcg ctcacagttc       180
     aaccaacgac tgcagctgag cgcggatatg cttattcggg ttagaaagtt cgtgagcttg       240
     ctagaacagc gactgaaatc aacatctatc agtgcgatag gattcaatga aaaggtagat       300
     cccgagagct gcgtttctac aatcgaaagg tgcacgcaaa ctgaagaatt gcttgaatca       360
     agcggcgtag aggagaaagc caccgaatgg actaaaatca tcgcgagact tcggtatgct       420
     cgagaaatgt taagcagagc taacgaggga aaaaacgaca acaatgcttc gggccggatc       480
     acacccttga agttccaagc gcaatcctta agcgcataca tctcaagtct tgatacgcgc       540
     gacgagacat tcaggaacca caagaatagt gttcaggcga tcagggatat gaagggctgg       600
     gttattaacg gaagagtgcg ttag                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page