(data stored in SCRATCH zone)

EMBL: CU928166.PE330

CU928166.PE330       Location/Qualifiers
FT   CDS_pept        complement(643482..644171)
FT                   /locus_tag="KLTH0B07942g"
FT                   /old_locus_tag="KLTH-ORF14823"
FT                   /product="KLTH0B07942p"
FT                   /note="some similarities with uniprot|P40154 Saccharomyces
FT                   cerevisiae YNL215W IES2 Protein that associates with the
FT                   INO80 chromatin remodeling complex under low-salt
FT                   conditions"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07942g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21695"
FT                   /db_xref="GOA:C5DD34"
FT                   /db_xref="InterPro:IPR006880"
FT                   /db_xref="InterPro:IPR029523"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD34"
FT                   /protein_id="CAR21695.1"
FT                   /translation="MDSDLSSVGSEDEIYEETPEVAEEELIGSEPEDDEYQYTPDDYEE
FT                   DEETGQRSKSGSRSSRRAATNEPRASNRKRAPTDEFEEPGSSPAKRARRNGAIDLQNLD
FT                   DDDDDDDDTSSASQQKLNSRNKMISELMDNTSRRSSKLTDQELQLRRAENARKRKNLSE
FT                   KKLEEEKQDTINKLLRRRAGKSRAAMPAAQEQENDAANYVKPRRAYNAQGLVRTLRKKD
FT                   VDIYATY"
     atggatagcg acctatcatc agtcgggtca gaggacgaaa tctatgaaga gacacccgag        60
     gttgcggaag aagagctgat aggctccgag ccagaagatg acgaatatca gtacacaccc       120
     gacgactacg aagaagacga ggagacgggc caacgatcca aaagcggcag caggtcctcg       180
     cgtcgagcgg ctacgaatga gccgcgtgct tctaatagaa agcgggcgcc cacggacgaa       240
     tttgaggagc caggatcgag ccccgctaag cgggcccgtc gcaacggtgc tattgattta       300
     cagaacctgg acgacgatga cgacgatgat gatgacacaa gcagcgcttc ccaacaaaag       360
     cttaatagcc gcaataagat gatctcggag cttatggaca atacctcccg gcggagctct       420
     aaactcaccg accaggagct gcagctgcgc agagcagaaa atgctcgcaa gcgcaagaac       480
     ctcagcgaaa aaaagcttga ggaagagaag caagacacaa tcaacaagct gcttcgcagg       540
     cgtgccggca aatccagagc tgcgatgcca gcagcccagg agcaagaaaa cgacgccgcc       600
     aactacgtca agcccaggag ggcctataat gctcaagggt tggttagaac gctgcggaaa       660
     aaagatgtag acatttacgc tacgtactga                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page