(data stored in ACNUC8465 zone)

EMBL: CU928166.PE331

CU928166.PE331       Location/Qualifiers
FT   CDS_pept        644343..646580
FT                   /locus_tag="KLTH0B07964g"
FT                   /old_locus_tag="KLTH-ORF14820"
FT                   /product="KLTH0B07964p"
FT                   /note="similar to uniprot|P48365 Saccharomyces cerevisiae
FT                   YDL234C GYP7 GTPase-activating protein for yeast Rab family
FT                   members including: Ypt7p (most effective) Ypt1p Ypt31p and
FT                   Ypt32p (in vitro) involved in vesicle mediated protein
FT                   trafficking"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07964g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21696"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="InterPro:IPR035969"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD35"
FT                   /protein_id="CAR21696.1"
FT                   /translation="MSTELLFCKSKVYVHCSKKAEDNIAGFLLITRDAQQPSLEATLSW
FT                   IPERELSKLQLNELNRADGNTAKLAKIKKELILQAQYAAWAFCIKINSIYSIQFRAPSP
FT                   SGWWYGSIAINSKNSHDQGSIPILFFHDKECASTQAKQKALNKSFDPFSGTDVYWGASD
FT                   FRDAIMQLVDFKQTLVDPTVWLVNATLDDLRNFSPQDKKVEAEASTKDSTSPKFWDMLD
FT                   QARWNVMSKFADFTSKSTNKVVNIWSQHPLVQFVDKHNNNPYVKKIMTNPKVQEIQDDF
FT                   DSARIYLAKWALGVKEQAEKYQTANGLDDTYRRLLFNELGSDGEDVKLTDEELNIAMQR
FT                   SHPLTRQKWDSFFDSEGRLLMTVQEVKDYIFHGGVADMELRKDVWLFLLEVYPWDSSLE
FT                   ERQVLTQTLRESYRANYKSKWEYRQPHSDEDEESYWHDQVLRVEKDVKRNDRDLSLYKY
FT                   NTETGEAPASPQQDFDQGAEQVDSDVWTVKNPHLQSLRSILLSYNIYNNDLGYVQGMCD
FT                   LLSPIYYILQDEELSFWAFVNFMRRMERNFLRDQSGIRDQMMALTDLCQLMLPKMSAHL
FT                   AKCDSSNLFFCFRMLIVWFKREFEFEDVCSIWEVFLTDFYSSQFQLFFMLAVLQKNSAP
FT                   VMNNLDQFDQVLKFFNELKGTMDWSDLMIRSELLFVKFKKIMDTLERRAELAEYTLLTS
FT                   DGSVINESSAAASEQNALATQTSLITENLKQLMSKKIVIKREPARNKHSIR"
     atgtcaacgg agctgctatt ttgcaagtcg aaggtgtacg tgcactgtag caagaaggcc        60
     gaggacaaca ttgctggatt cttgctgatt acgagggacg cacagcaacc atcccttgaa       120
     gccactttgt catggattcc agagagagag ctaagcaaac tacagctgaa tgagctcaac       180
     cgagctgatg ggaatacagc aaagctagca aagatcaaga aagaattaat attgcaggcg       240
     cagtatgccg catgggcgtt ttgcattaaa attaacagca tttattcgat tcagttccgc       300
     gcaccaagcc ctagcggttg gtggtatggt tcgattgcta tcaactcaaa aaactcgcat       360
     gaccaaggat caattcccat actgttcttt catgataagg agtgtgcgtc cacccaggcg       420
     aagcagaagg cgttgaacaa atcttttgat ccgttttcag gaacagacgt ttattggggc       480
     gcaagcgact tccgagatgc aataatgcag cttgtcgact tcaaacagac gcttgtggac       540
     cccacggtgt ggcttgttaa cgcaacatta gacgatctca ggaatttttc accacaagac       600
     aagaaagttg aggccgaagc cagcacaaaa gactccacct cacccaaatt ctgggatatg       660
     ctagatcaag ccagatggaa cgtcatgtcc aaatttgctg actttacttc gaagtctact       720
     aacaaggtgg tcaatatttg gagtcagcac cctttggtac agtttgtcga taagcacaac       780
     aacaaccctt atgtcaaaaa gattatgacc aatcccaagg ttcaggaaat tcaagatgat       840
     ttcgactctg caaggattta ccttgcaaag tgggcattag gagtaaagga gcaagcagag       900
     aaatatcaaa cggcaaacgg cctcgatgac acctaccggc gccttctttt caatgagcta       960
     ggaagcgatg gcgaggatgt caagttaact gatgaagagc tcaatatagc catgcagagg      1020
     tcccatcctc taacgagaca aaaatgggac tctttctttg actcagaagg gcggctgctc      1080
     atgactgtgc aagaggttaa agactacatc tttcatggag gtgttgcaga catggagcta      1140
     agaaaggatg tgtggctctt tctattagaa gtttatcctt gggactcttc tttggaagaa      1200
     aggcaggtgt taactcaaac attgagggag agctaccgtg caaattacaa aagtaaatgg      1260
     gagtaccgcc aaccgcattc agatgaagac gaagaatctt actggcacga tcaagttctt      1320
     cgtgttgaaa aagacgtcaa acgtaatgat agggatttgt ccctgtacaa gtacaacacc      1380
     gaaacgggtg aagcccctgc ctcgccccag caagacttcg atcaaggagc cgaacaagtt      1440
     gatagcgatg tttggacagt gaagaaccct catcttcaaa gtctccgcag tatcctcctg      1500
     agttacaaca tctacaataa tgacttaggg tatgtgcaag gaatgtgcga cttgttgtcg      1560
     ccaatttatt acattcttca ggatgaagaa ctatcatttt gggcgtttgt aaactttatg      1620
     cgccgtatgg aaaggaactt ccttagagat cagtctggca tccgcgacca aatgatggct      1680
     ctgactgact tgtgccaact aatgcttcca aagatgagtg cacatcttgc aaagtgtgat      1740
     tcctctaact tgtttttctg cttccgcatg cttatcgtct ggtttaagcg tgagtttgaa      1800
     tttgaagacg tttgcagcat atgggaagtg tttctcacag atttctactc ctcacagttt      1860
     cagcttttct tcatgctcgc tgtgctccaa aaaaacagcg ctcctgttat gaacaatctt      1920
     gatcaattcg atcaggtttt gaagttcttc aatgagttga aaggaaccat ggattggagt      1980
     gatttgatga tccggagtga gcttctgttt gttaagttca agaaaatcat ggatacgctt      2040
     gaaaggcgag cagaactggc ggaatacact cttttgacaa gcgatgggag tgtcatcaac      2100
     gaaagctcag ctgcggctag tgaacaaaat gctttggcaa ctcaaacttc actgatcacc      2160
     gaaaatctga aacagttgat gtctaagaaa atagtcatca agagagagcc ggctaggaat      2220
     aagcactcaa ttaggtag                                                    2238
//

If you have problems or comments...

PBIL Back to PBIL home page