(data stored in ACNUC8465 zone)

EMBL: CU928166.PE332

CU928166.PE332       Location/Qualifiers
FT   CDS_pept        complement(646727..648892)
FT                   /locus_tag="KLTH0B07986g"
FT                   /old_locus_tag="KLTH-ORF14818"
FT                   /product="KLTH0B07986p"
FT                   /note="similar to uniprot|P11938 Saccharomyces cerevisiae
FT                   YNL216W RAP1 DNA-binding protein involved in either
FT                   activation or repression of transcription depending on
FT                   binding site context also binds telomere sequences and
FT                   plays a role in telomeric position effect (silencing) and
FT                   telomere structure"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B07986g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21697"
FT                   /db_xref="GOA:C5DD36"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015280"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="InterPro:IPR021661"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR038104"
FT                   /db_xref="InterPro:IPR039595"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD36"
FT                   /protein_id="CAR21697.1"
FT                   /translation="MSQQDDFETPSTNAFEDALEHQSQHYEDGKPDTRSDKDASGKDEG
FT                   AGSGGDDQQDIFQDLGFFIAHDESRQELEQLVSGHGGTVLSELPSGKSNKEFVVSTINA
FT                   SDLPTVTPTYIKTCCENNVLMKVQPFLVPYNEFRAVIDTQLQNESGEKPTAPADDASET
FT                   AEQPVESPSTKPGEDKRPDADTPQPSETNGGPMASVTAESNAGSEDQGAGARRESVDSA
FT                   KNSISGDESDVVKTPVAPSPPSARQPAASHNKSSFTEEEDEFILDVVRKNPTRRTTHTL
FT                   FDEISHYVPKHTGNSIRHRYRVYLAKRLNFVYQVDSTGKLVRDDNGDLIKTTVLPKSLK
FT                   NKFTASEDYALSVEVKKQFYRDIYQMDPDTGESLIKDINAPDGNLKGSFGAGSDERQNP
FT                   GPSFKDFRVGERRGPVPREFFKKYADENPNHTENAWRDRFRKFLLTFGIDRYIEYYENE
FT                   IAQSRVPQAMKNMTNRPKRPGVPTPGNYNSFAKKVKTLSQQQQQQAAAIIAANGGAIDP
FT                   AALAFAIPEGDFLDEETLNFISGLRRDLSKIESAGGAAFAYPQEIAESIRNDFTNEEAQ
FT                   FDEIDPDKIPFPPALVTNELFMPQFFHFGSTREFLDKINEVISRDYEPSQAEKLVQDLC
FT                   DDVGVRKTFSTSILTALSGDLMVFPRYFLCMFHFGSNPPMNIPGIWTREDDEMLRSGEE
FT                   SNIKKLTQKHGAGRIEMRKRFIASDLV"
     atgtctcagc aagatgactt cgaaacacct tccacaaacg cgtttgagga cgcgctagaa        60
     caccagtcac agcattacga ggatggcaag cctgatacac ggagcgacaa ggacgcgtct       120
     ggcaaggacg aaggcgccgg cagcggaggt gacgaccaac aagacatatt ccaagatcta       180
     ggtttcttca ttgcacatga cgagagtcgc caggagttgg agcagctggt cagcggccac       240
     ggcgggactg tgctttcgga gctgccctct ggcaagtcca ataaggagtt tgttgtttcc       300
     acgataaacg cctcagacct gcccacagtg acgccgacgt acatcaaaac atgctgcgaa       360
     aacaacgtgc ttatgaaggt gcagcccttc ttggttccct acaatgagtt ccgcgctgtg       420
     atagatactc agctccagaa tgaaagcggg gaaaaaccga cagcacccgc ggacgacgcg       480
     tcagagacgg cggagcagcc agttgaatct ccgtctacta aacctggcga agataaaagg       540
     cctgacgcag acaccccaca accatctgaa acgaacggtg ggcctatggc ttcggtcaca       600
     gccgagtcca atgctggctc cgaggatcaa ggcgctggcg cccgaagaga aagtgttgat       660
     tccgcaaaga atagcattag cggagatgag agcgatgtcg ttaagacccc cgtggcgcca       720
     agcccaccct ctgcgcgtca gcccgccgca tcccacaaca agtcctcatt cacagaagag       780
     gaggacgaat ttatccttga cgtagtgcgt aagaatccca caagacgcac cacccacacc       840
     ctttttgacg agatttcaca ctatgtgcct aagcacacgg gcaactctat aaggcatcgc       900
     tatcgggttt atcttgcaaa acggctgaat tttgtatatc aggttgacag taccggcaag       960
     ctggttcgag acgataatgg cgaccttatc aagaccactg ttttgccaaa atcactcaag      1020
     aataagttca ctgcctcaga agactacgcg ctctccgttg aagttaaaaa gcagttttac      1080
     cgtgacattt atcagatgga tcctgatact ggagagtcat taattaaaga cataaatgct      1140
     cctgacggaa atctgaaggg ctctttcgga gctggtagcg acgaacgcca aaacccagga      1200
     ccctctttca aagatttccg ggttggcgag cgccgtggcc ctgttcctag agagtttttc      1260
     aaaaagtatg ctgatgagaa cccaaatcac accgaaaacg cgtggagaga tagatttcgc      1320
     aagttcttgt taactttcgg tattgacagg tacattgagt actacgaaaa cgagattgct      1380
     cagagcaggg ttccacaagc gatgaagaac atgacaaaca gacccaaaag gccaggtgtc      1440
     ccaactccag gtaattacaa cagcttcgcc aagaaagtca agacgctgtc tcaacagcag      1500
     cagcaacagg ctgccgctat tatcgcagca aatggcgggg ctattgaccc cgcagcactt      1560
     gcgttcgcta tccctgaagg tgatttcttg gatgaagaaa cgcttaactt catttccggt      1620
     ctcagacgcg acctttccaa aatcgagtct gctggtggtg cggcttttgc gtatcctcaa      1680
     gagatcgcag aatctattag aaatgacttt acgaacgagg aagcccagtt tgatgaaatt      1740
     gaccctgata aaattccctt cccacctgca cttgttacca atgaactgtt tatgcctcag      1800
     ttcttccact ttggtagcac cagggagttt ttggataaaa tcaacgaggt tatatccagg      1860
     gattacgagc cctctcaagc tgaaaagcta gtacaagatc tttgcgacga tgtgggtgtc      1920
     cgtaaaactt tcagcactag cattctcact gccctctcag gtgacttgat ggtttttccc      1980
     aggtactttc tctgtatgtt ccactttggc tctaatccac ccatgaatat cccaggcatc      2040
     tggactcgag aagatgatga aatgttgaga tctggagagg agtcgaacat caaaaagttg      2100
     acccaaaaac atggcgcagg gagaatcgag atgaggaaaa ggtttatcgc tagcgatttg      2160
     gtatag                                                                 2166
//

If you have problems or comments...

PBIL Back to PBIL home page