(data stored in ACNUC8465 zone)

EMBL: CU928166.PE334

CU928166.PE334       Location/Qualifiers
FT   CDS_pept        652379..652795
FT                   /locus_tag="KLTH0B08030g"
FT                   /old_locus_tag="KLTH-ORF14803"
FT                   /product="KLTH0B08030p"
FT                   /note="similar to uniprot|Q07688 Saccharomyces cerevisiae
FT                   YDL235C YPD1 Phosphorelay intermediate protein
FT                   phosphorylated by the plasma membrane sensor Sln1p in
FT                   response to osmotic stress and then in turn phosphorylates
FT                   the response regulators Ssk1p in the cytosol and Skn7p in
FT                   the nucleus"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08030g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21699"
FT                   /db_xref="GOA:C5DD38"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD38"
FT                   /protein_id="CAR21699.1"
FT                   /translation="MNTVPIPAGVINWNTLNEIVSMDEDSPDFSKNLIIQYLEQANTTF
FT                   DQIEQELQGNCDLEQLASLGHFLRGSSAALGLQRISWACERIQNLGRKREGGVEGQQLP
FT                   DSHYAQLITNALQCARNEFKAAKAELSAFYKSEL"
     atgaatacag tgccgatccc agccggggtg atcaactgga acacgctcaa tgaaatagtg        60
     tcaatggacg aggacagtcc ggacttttcc aaaaacttga taattcagta cctcgagcag       120
     gccaacacga catttgacca gatagagcag gagctgcaag gaaactgcga tctcgagcaa       180
     ctggcatcgc tgggtcactt cctgcgtggc tcgtccgcag cattggggct gcagcgcatc       240
     tcgtgggcat gtgagcgcat tcagaacttg gggcgcaaac gcgagggtgg cgtcgagggt       300
     cagcagctgc ccgattcgca ctacgcacaa ttgattacaa atgctctgca atgcgcccga       360
     aacgagttca aagctgcaaa agcagaactt tctgcatttt acaagtctga actttag          417
//

If you have problems or comments...

PBIL Back to PBIL home page