(data stored in ACNUC8465 zone)

EMBL: CU928166.PE335

CU928166.PE335       Location/Qualifiers
FT   CDS_pept        complement(652928..654538)
FT                   /locus_tag="KLTH0B08052g"
FT                   /old_locus_tag="KLTH-ORF14800"
FT                   /product="KLTH0B08052p"
FT                   /note="similar to uniprot|P40151 Saccharomyces cerevisiae
FT                   YNL218W MGS1 Protein with DNA-dependent ATPase and ssDNA
FT                   annealing activities involved in maintenance of genome
FT                   interacts functionally with DNA polymerase delta homolog of
FT                   human Werner helicase interacting protein (WHIP)"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08052g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21700"
FT                   /db_xref="GOA:C5DD39"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR006642"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD39"
FT                   /protein_id="CAR21700.1"
FT                   /translation="MNTSKSEQLISCPVCNLKVKYSAINSHLDKCTGDGKTSKKEPTLS
FT                   SFLKGKRKQASDEPEIIEVEEKVKKPKSQPSKGENADVRNLQKIAHQPLSEKLRPKELA
FT                   EYVGQQHIISSEHGVLYKFVQQGIIPSMILWGPPGVGKTSLARLLTKAVNQSHANGVTY
FT                   TLIQTSATKATAQELRKIFENSRREFSLTKRITVVFIDEIHRFNKGQQDLLLPHVEAGD
FT                   IVLIGATTENPSFQLNNALMSRCQIFVLTKLSTDEMCLVLSRGIAMLNKCRHLIWKVNH
FT                   PLKLDRSVLEFVVDISMGDTRRALNLLEMIEVSTRDDAKELKEEDIREIINGNSTELRT
FT                   YYDRQGENHYDTISAFHKSVRGSDENAALYYLARMLQGGEDPLYIARRMIRIASEDIGV
FT                   LDNSLLPLAVAAHDAVMKVGLPEADLALAQCSVALARAPKSVQLYRAWKQVNAKLRENQ
FT                   NSFASCGIPMHLRNAPTKLMAELGYARDYKYNPDFENGEVAQDYFPDEVIAACDRQELK
FT                   FMAGLHLGSQKDPEIAKQP"
     atgaacacat caaaaagtga acaattgata tcatgccccg tctgcaactt gaaggttaag        60
     tactcagcta tcaactcaca cctggataag tgtactggcg atggaaagac aagcaaaaaa       120
     gagcccacct tgagtagctt tctcaagggg aagcgaaagc aggccagtga cgaaccagag       180
     atcattgagg ttgaggaaaa ggttaaaaag cccaaatcgc agccttcaaa aggtgaaaat       240
     gcagatgtta ggaaccttca gaaaatcgca caccaacctt tgagcgaaaa gctaagacct       300
     aaagaacttg cagagtacgt cggtcagcag catattatct cttcagagca cggggtactc       360
     tacaagtttg tccagcaagg cattattcct tcaatgatcc tttggggtcc tccaggagta       420
     gggaaaacgt cgttggcacg gcttttgacc aaggcagtca accaaagcca cgccaacggg       480
     gtgacttata cgctaattca gactagcgca actaaagcaa ccgcacagga acttcgaaag       540
     atctttgaaa attccagacg cgaattttcg ctaactaaaa ggattacggt ggttttcatc       600
     gacgagattc acagattcaa caagggtcag caagatctcc tgctgcccca tgtagaggca       660
     ggcgatattg tattgattgg ggcgaccacg gaaaacccca gcttccaatt gaacaacgct       720
     ttaatgagtc gctgtcaaat atttgttctg acaaagctca gtactgacga aatgtgcttg       780
     gtgctttcgc ggggcattgc catgctcaac aagtgccggc acttgatttg gaaagtcaat       840
     cacccactaa agttggaccg gagtgtgctg gaatttgtgg tggacatctc aatgggagat       900
     accagaagag ccctaaacct gcttgagatg atcgaggttt ccaccagaga cgatgcaaaa       960
     gagttgaaag aagaagacat tcgcgagatc atcaacggaa attctacgga actgcgaaca      1020
     tattacgata gacagggcga gaaccattat gacacaattt ccgcgtttca caagtcagtg      1080
     cgcggaagcg acgagaacgc tgcgctctac taccttgcgc gtatgctaca aggaggggag      1140
     gacccgcttt atattgctcg ccgaatgatc cgaatagcgt cagaggacat aggcgtgctc      1200
     gacaattcgc tactgccatt ggcggtagct gcgcacgacg cggttatgaa ggttggcctt      1260
     ccagaagcgg atctagcact ggcacaatgc agcgttgcgc ttgccagagc gcccaaatct      1320
     gtgcaactat atagagcttg gaaacaggtg aatgccaagc taagagaaaa ccaaaactcg      1380
     tttgcgagct gcggcatccc catgcatcta cgcaacgcac caacgaaatt gatggcggaa      1440
     ctggggtacg ctcgggacta caagtacaac ccagatttcg aaaacggcga ggtcgcgcaa      1500
     gattacttcc cagacgaagt aatcgcggcg tgcgatcggc aggagctgaa gttcatggct      1560
     ggacttcacc tcggcagcca aaaggacccc gaaatagcta aacagccctg a               1611
//

If you have problems or comments...

PBIL Back to PBIL home page