(data stored in SCRATCH zone)

EMBL: CU928166.PE339

CU928166.PE339       Location/Qualifiers
FT   CDS_pept        complement(659691..661397)
FT                   /locus_tag="KLTH0B08140g"
FT                   /old_locus_tag="KLTH-ORF14782"
FT                   /product="KLTH0B08140p"
FT                   /note="similar to uniprot|P32837 Saccharomyces cerevisiae
FT                   YDL210W UGA4 Permease that serves as a gamma- aminobutyrate
FT                   (GABA) transport protein involved in the utilization of
FT                   GABA as a nitrogen source catalyzes the transport of
FT                   putrescine and delta-aminolevulinic acid (ALA) localized to
FT                   the vacuolar membrane"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08140g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21704"
FT                   /db_xref="GOA:C5DD43"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD43"
FT                   /protein_id="CAR21704.1"
FT                   /translation="MEKAQAVANSTDVSSSLEQAVGDIHQIGSLRTITSKRAGEVNFID
FT                   AKRAHGDAELLAEIGYKQELNRHFSTVQVFGVAFSIMGLLPSIASVLAIGMPGGMVSLV
FT                   WGWFIAGIFILAVGCGMSELASAIPTSGGLYYYTYYYAPQKYKAFFSFVIGYSNSLALV
FT                   SGLCSITYGLAEEILSIVVVSKDGDFTITNGKTYGVFVAGIAATTVVTSIATVAVSKLQ
FT                   TVSILANVGLIVLFFIVLPIGVANTKGLDFNDGSFIFGKWLNETTWPDGWQFMLAGLQP
FT                   AIWTIGAFDSCIHMSEEAKNATKAVPLGIISSISVCWILGFLICIVMAACMGPDIDAIL
FT                   GSSFGSPLPQILYNALGKKWTIAIMTLIAACQFLMGCSILTAISRQIWAFARDDGLMFS
FT                   KYIKVVNKKLSSPLRATWFGAVCALVIGLLCLIGGTASNALFSLGIGGNYLAWMAPNLL
FT                   RMTTGKDLFRPGAFYMGKTWSPIVNWTAIVFQIFILIMIMFPAESKGITPDAMNYTVVI
FT                   CGGVWIGSMIYFFVYKKKAFNGPKSNLSDDEYVDAVGQDVIDQILSHQKSG"
     atggaaaaag cccaggcggt agcaaacagc acagatgtca gctcatcact tgagcaggca        60
     gttggcgata ttcaccaaat agggtctttg agaaccatca cgtcgaaaag ggctggtgag       120
     gtcaacttca ttgacgcaaa gcgtgcgcac ggcgacgcag agcttctggc agaaatcggt       180
     tacaaacagg aactgaacag gcacttcagc actgtgcagg tgttcggtgt agcattttcg       240
     atcatgggtc tgctccctag cattgcgtcc gtgttggcaa tcggcatgcc aggaggcatg       300
     gtatccctag tatggggatg gttcatcgca ggcatcttca tcttggccgt cgggtgcggg       360
     atgtccgagc tggcatcggc tattccaacc tccggtgggc tttactacta cacatattac       420
     tacgcgcctc agaaatacaa ggcatttttt agttttgtga tcggctactc aaactcgctg       480
     gcgcttgtct cgggtctgtg ttctatcact tatggtctgg cagaagaaat cttatcgatc       540
     gtggttgttt ccaaggatgg cgactttacg attacgaacg gcaagacgta tggagtgttc       600
     gtggctggca ttgcagcaac cacagtcgtc acctctatcg ccactgtcgc ggtgtcgaag       660
     ctacaaacgg taagtattct ggccaatgtg ggcttgattg tgctcttctt cattgtgctg       720
     cccattggcg tggcgaacac aaagggtctc gattttaacg acgggtcctt catttttgga       780
     aagtggctaa acgagacaac ctggccagac ggatggcaat tcatgctggc tggtctccag       840
     cccgctattt ggaccattgg cgcctttgac tcctgtatcc acatgtccga agaagccaag       900
     aatgccacca aggctgtgcc tttgggtatt atctcgtcta tcagtgtctg ctggattttg       960
     ggcttcctaa tctgtatcgt tatggcagcc tgcatgggcc ctgacattga cgctatctta      1020
     gggagttcat tcggctctcc gctaccccag atcctgtaca acgcgcttgg aaagaaatgg      1080
     acgattgcca tcatgacctt gatcgctgcg tgccagtttt tgatgggatg ctcgatcttg      1140
     actgccatct ctagacaaat ctgggcattt gcgcgtgatg acggtctgat gttctctaag      1200
     tacatcaagg tggttaacaa aaagctttcc tctcctctaa gggccacttg gttcggagcc      1260
     gtgtgcgcgc ttgtcatcgg gttactgtgc ctgatcggag gtactgcctc gaacgccctg      1320
     ttctccctgg gtatcggggg caactatctc gcgtggatgg ctcctaatct attgagaatg      1380
     actacgggca aggacctgtt cagaccgggc gctttctaca tggggaagac gtggtctcca      1440
     attgtgaact ggaccgccat tgttttccag atcttcattc tgatcatgat catgttcccc      1500
     gcggaaagca agggcatcac gccggacgcc atgaactaca ctgtagttat ttgtggcggc      1560
     gtgtggatcg gaagcatgat ctactttttc gtgtacaaaa agaaggcctt caatggtccg      1620
     aagtcgaatc tcagcgacga tgagtatgtg gatgccgtgg gtcaagacgt catcgaccag      1680
     attttgtcgc atcagaaaag cggctag                                          1707
//

If you have problems or comments...

PBIL Back to PBIL home page