(data stored in ACNUC8465 zone)

EMBL: CU928166.PE34

CU928166.PE34        Location/Qualifiers
FT   CDS_pept        complement(89368..89970)
FT                   /locus_tag="KLTH0B01056g"
FT                   /old_locus_tag="KLTH-ORF15872"
FT                   /product="KLTH0B01056p"
FT                   /note="similar to uniprot|P47123 Saccharomyces cerevisiae
FT                   YJR074W MOG1 Conserved nuclear protein that interacts with
FT                   GTP-Gsp1p which is a Ran homolog of the Ras GTPase family
FT                   and stimulates nucleotide release involved in nuclear
FT                   protein import nucleotide release is inhibited by Yrb1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01056g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21399"
FT                   /db_xref="InterPro:IPR007681"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC88"
FT                   /protein_id="CAR21399.1"
FT                   /translation="MFQKQALYGGAISTVIPKGFLDASILREVPDTQEVFVNSREEKEI
FT                   AVFKDGLGLDESVIVDLLQRVEEDDSCRALDVHLQEIAGLNGSHEWNLVECEQSAPEVG
FT                   QVPHLTCIAVEAAYKWGKSDMRETLVLCVALLRFDDVQTDVVLSVNIPVTSEPELQLLN
FT                   AWLSKTSSTIPLRIAAAYHLVKQMASEFRILDKGLFV"
     atgtttcaga agcaagcgct ctacggtggt gcaatctcca ccgtcattcc caaaggattt        60
     ttggacgcct ctattctgcg tgaggtcccc gacacgcaag aggtgttcgt gaatagcagg       120
     gaagaaaagg aaattgcggt attcaaggac ggcctagggc tcgacgaaag cgtcatagtg       180
     gaccttctac agcgcgtcga ggaggacgac agctgccgcg cgcttgacgt tcatttgcaa       240
     gaaattgcag ggctaaacgg aagtcacgag tggaacttag tcgaatgcga gcagagcgct       300
     cccgaagtcg gccaagttcc tcacctcacc tgcattgcag tcgaggctgc ctacaaatgg       360
     ggcaaaagcg acatgcgtga gacgcttgtg ctgtgtgtcg cgctgctgcg cttcgacgac       420
     gtacaaacgg atgtagtgct tagcgtcaac atccctgtca catccgagcc agagcttcag       480
     cttttgaacg cctggctcag taagacgagc tcaaccattc cgctcagaat tgcggccgcg       540
     taccatctcg tcaagcagat ggcttctgaa ttccgtattc tagataaagg tctattcgta       600
     tga                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page