(data stored in ACNUC8465 zone)

EMBL: CU928166.PE340

CU928166.PE340       Location/Qualifiers
FT   CDS_pept        661997..664531
FT                   /locus_tag="KLTH0B08162g"
FT                   /old_locus_tag="KLTH-ORF14778"
FT                   /product="KLTH0B08162p"
FT                   /note="similar to uniprot|P41812 Saccharomyces cerevisiae
FT                   YNL221C POP1 Subunit of both RNase MRP which cleaves pre-
FT                   rRNA and nuclear RNase P which cleaves tRNA precursors to
FT                   generate mature 5' ends binds to the RPR1 RNA subunit in
FT                   Rnase P"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08162g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21705"
FT                   /db_xref="GOA:C5DD44"
FT                   /db_xref="InterPro:IPR009723"
FT                   /db_xref="InterPro:IPR012590"
FT                   /db_xref="InterPro:IPR039182"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD44"
FT                   /protein_id="CAR21705.1"
FT                   /translation="MSGKKPRSQNQLYRRRKVQDARNIRTEALKSGAQASQELSESGGM
FT                   MRVPEFMASREFEVKQLQVAMHKSKSASSTRVFQSLPRKLRRRTASHNVKRIPKRLRNR
FT                   ALREMQKSDQAVTRGTEKPSRQRRSGLTAKQLYKARMTVKLLRLAARSKSMKLALPAQV
FT                   TGSQTKLRQRIRALQKTLRAEAKPGTAQLRNNQMGSYDCTGIGKLAPRPVGRIKYMKRQ
FT                   RVFTWLPTHVWNAKRSHMLKRWGYQMPWSPTQKCFKLTHRIGGNTAASDGALCCDSSYM
FT                   GTMIVASADTEALRLLAHQLTNKRATLPKYRVSGHWFEGLIYDENAEAVGPGEILWISS
FT                   NKLLLRLHPAIYSRVFEQISLANSEKKFVIQDCRFSIGSITLSGGKSLNALSQVLRSTT
FT                   ASKSYNQFKTVAYVTDTNVLPQRTVFAFEAIDPRHLSNPRALPKANINANDVLKLQAEY
FT                   PREEIAEVLEKLCNPDKREMSYKNQQTLKQLAYRRRMLLESTARTNAIPHDSKEDPFIP
FT                   IAIFKRPKQESWVVLLPWFWLLPLWYQLNRVSRVYHMGLRQLQQLSFEQRRLYFPDDYP
FT                   FTQAGYDENSTFKRLSQEALWKRKPAGKRVNFDKISGIHTENPVRFPGEIGDPFSCDWR
FT                   LLQVLRNGIDFLRTRDQGPIRMYDPKRTSQFDELNMRKLMYVNDIIDLYSDVQDKKLTP
FT                   SALPISIFTKSVKGANSGCPQYGNSPRMQIVTTPLQVAAVSCVLQEQGHPKDFARVYAI
FT                   PAQDMDYWLSIVNIKARSNGKRDHDTAQPTPGVQDLIGFVTSGTFHLGDGRGACTAFIA
FT                   AQEACKSPNEYVLIRNVGTNVYRVAKWEQIAL"
     atgtctggaa agaagcccag aagtcagaac cagctataca gacgccggaa ggttcaagat        60
     gcacgaaata tccggacgga agcactgaag tcgggagccc aagcgtcgca ggaattatca       120
     gagagcgggg gaatgatgcg agttcccgag tttatggcct cgagagagtt cgaggttaag       180
     cagctgcaag tggcaatgca taaatccaag agcgcgtcgt ccaccagggt ttttcagtct       240
     ttgcctcgaa agcttcggcg acggaccgcg tcgcacaacg taaagcgaat tcccaagcga       300
     ttgcgtaatc gggcgttgcg cgagatgcag aaaagcgacc aagcggtgac acgcggtacg       360
     gagaagccct cccgccagcg tcgaagcggg ctcacggcga aacagctgta caaggcgcgc       420
     atgactgtga agctgctgcg actagctgcg cgctcaaaga gcatgaaact cgcgcttccg       480
     gcgcaagtga ctggatctca aaccaagctt cgtcagcgca tccgggcgct tcagaagacc       540
     cttcgcgcag aagcaaaacc tggcacagcg cagctacgca ataatcagat gggcagttac       600
     gattgcaccg gaattggtaa attggcacca cgccctgtag gccgtatcaa gtatatgaag       660
     cgtcaacgcg tcttcacatg gcttcccacg cacgtttgga atgccaagcg gtcccacatg       720
     ctcaaacggt ggggctacca gatgccttgg tcccctacgc aaaaatgctt caagctcacg       780
     catcggattg gtggcaatac agcagcctct gatggcgcgc tatgctgcga ctccagctac       840
     atgggcacca tgattgttgc ctccgcggac accgaagctc tgaggcttct cgcgcatcag       900
     ctcacaaata aaagagcaac gctccccaag tatagagttt cgggccactg gtttgaaggt       960
     ctaatctatg atgaaaatgc cgaagccgtg ggtccgggcg aaattctctg gatcagttcc      1020
     aataagcttt tgttgagact tcaccctgca atttactcgc gagtgttcga gcagatttct      1080
     ttggccaact ccgaaaagaa gtttgtcatc caagactgtc gcttctctat tggaagcatc      1140
     acacttagcg gcgggaagtc tctcaatgca ttatcacaag tcttgcgcag cacaactgca      1200
     tcgaagtctt acaaccagtt caagaccgtc gcatatgtta ccgatactaa cgtcctgcct      1260
     caaagaacag tattcgcttt cgaggcaatt gacccaagac atctttctaa ccctagggcc      1320
     cttccaaagg ctaacattaa tgcgaatgac gtcttaaagc ttcaagcgga gtacccccgg      1380
     gaagaaatag ctgaggtgtt ggaaaagctt tgtaaccctg acaagcgtga gatgtcgtac      1440
     aagaaccagc agacgctgaa acagttggcg tacaggcgtc gaatgcttct agagtctacc      1500
     gcgcggacaa acgccattcc acatgactcc aaagaagacc catttattcc gatagctatc      1560
     ttcaaacgac caaagcaaga gtcttgggtc gttttgctgc cgtggttttg gctattgcca      1620
     ctgtggtacc agttgaatcg ggtctcgagg gtctatcaca tggggctgcg ccagctacaa      1680
     cagctgagct tcgaacagcg cagactgtat ttcccggatg actacccatt cacacaagca      1740
     ggctacgatg aaaactcaac gtttaagcgt ctctcacagg aggcgctatg gaaacgcaaa      1800
     ccagctggca aacgcgtgaa cttcgacaaa atatctggaa ttcatactga aaatccagtt      1860
     cgctttcctg gcgagattgg cgatcctttc agttgcgact ggcggctctt gcaagtcctg      1920
     agaaacggga ttgactttct acgaactcgc gatcaaggcc ccattcgcat gtatgatccc      1980
     aagcgcacct ctcagttcga cgaactaaac atgcgcaaac taatgtacgt caatgatatt      2040
     atcgacttgt actctgacgt gcaagacaaa aaattgacgc ccagcgcctt gcctattagc      2100
     atatttacaa agtctgtcaa aggtgccaac tctggctgcc cccaatacgg taactcgcca      2160
     cgcatgcaga tagtaacaac accacttcag gttgccgcgg tttcgtgtgt gctacaggag      2220
     cagggtcatc caaaggattt cgcccgcgtc tacgccatcc ctgctcaaga catggattac      2280
     tggctatcga ttgtaaacat caaggcacgt tccaatggga aaagggatca tgacactgcg      2340
     caacctactc ctggagttca agaccttatc ggatttgtta caagtggtac gttccacctt      2400
     ggcgacggta gaggcgcctg tacagccttt atcgcggccc aagaagcttg caagagtcct      2460
     aacgaatacg tattgatcag aaacgttggc acgaacgtct accgcgttgc caaatgggaa      2520
     cagatcgcat tataa                                                       2535
//

If you have problems or comments...

PBIL Back to PBIL home page