(data stored in ACNUC8465 zone)

EMBL: CU928166.PE342

CU928166.PE342       Location/Qualifiers
FT   CDS_pept        667368..668792
FT                   /locus_tag="KLTH0B08228g"
FT                   /old_locus_tag="KLTH-ORF14772"
FT                   /product="KLTH0B08228p"
FT                   /note="similar to uniprot|Q07729 Saccharomyces cerevisiae
FT                   YDL238C GUD1 Guanine deaminase a catabolic enzyme of the
FT                   guanine salvage pathway producing xanthine and ammonia from
FT                   guanine activity is low in exponentially- growing cultures
FT                   but expression is increased in post- diauxic and
FT                   stationary-phase cultures"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08228g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21707"
FT                   /db_xref="GOA:C5DD46"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR014311"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD46"
FT                   /protein_id="CAR21707.1"
FT                   /translation="MILKLTVYHGNFVDTPSLGDVRIRPQTTIGVGTDGKILFIKEKSQ
FT                   DPLRDALDFDQTLQPSEVAVVKISGSQDGSFFFPGFVDTHVHASQYPNAGIFGSSTLLD
FT                   WLQTYTFPLEASLKDADTARAVYNRVLDRTLANGTTTASYYTTIDAASSNLMARICAEK
FT                   GQRAFIGKVCMDQNSPDYYVELFKECKHSTRQVVDYIKKELKDEKIQPVLTPRFAPSCS
FT                   RELMSWLGQLAHEEDLNVQTHLSENLAELELVAELFPECENYSQVYDNHHLLTKKTLLA
FT                   HCVHLSDKEIELLKLRGCGVSHCPISNSSLASGECRVRLLLDNGINVGLGTDLSGGYSS
FT                   SILAVARQALLVSRHLAMKETDAKKQEHVNLSVEDVLFLASLGGAQALSLGSVVGSFEV
FT                   NKQFDAQLINLDPVSSNVDVFEWQRTSWNDSPKEGENQKLARNLLAKWLFTGDDRNTAR
FT                   VWVAGRLVHSYPASAT"
     atgattctaa agcttactgt gtaccacggg aattttgtgg ataccccttc ccttggggac        60
     gtgcggatca gacctcaaac gacaattggt gttggaacag acggcaagat cctgttcatc       120
     aaggagaagt cgcaggaccc gctaagggat gcactggatt ttgatcagac tctccagcca       180
     tcggaggttg ccgttgttaa aatttcaggc agccaagacg gctcattctt cttccccgga       240
     tttgtcgaca cacacgtaca tgcgtcgcag tatcccaacg cagggatctt tggttcatcg       300
     acactgctgg actggctgca gacgtacacg ttcccgctcg aggcgtcgct caaggacgca       360
     gacacagcgc gggcggtgta caacagggtt ttggaccgga ccttggccaa cggcaccact       420
     acagcctcgt attacaccac tatcgacgcc gcgtcttcga acttgatggc gaggatctgc       480
     gccgagaagg gccagcgcgc cttcattggt aaggtctgta tggaccagaa ttcgccagat       540
     tactatgttg agttattcaa agaatgcaag cactcgacgc gccaagtcgt tgattacatc       600
     aaaaaggaac tcaaggacga gaaaatccag cccgtactga ccccaaggtt tgcgcccagc       660
     tgctcccggg agctgatgtc gtggttgggc cagctggcgc acgaagaaga tctgaatgtt       720
     cagactcatc tgtctgaaaa cttggcggag cttgagctag ttgcagagct gttcccagaa       780
     tgtgagaact attcacaggt ttacgacaat catcatctac ttacaaaaaa aaccctgttg       840
     gcacattgtg tacacctgtc agataaagag atagagctgc taaaactgcg aggctgtggc       900
     gtctcgcact gtccgatttc gaactcgtct ttggcctccg gagaatgccg cgttcgcttg       960
     cttttggata acggcatcaa tgtcggcctc ggtactgatc tgtctggggg ctatagctca      1020
     agcatcctgg cagttgcaag acaggcatta ttggtgtcga ggcacttggc gatgaaggaa      1080
     actgatgcaa agaagcaaga gcatgtcaac ctttccgttg aggatgttct ttttctagct      1140
     tcgctgggcg gagctcaggc tttgagtcta ggtagtgtcg ttggaagttt cgaggtgaac      1200
     aagcagtttg acgcgcagct tattaaccta gatccggtga gttccaatgt ggacgtcttc      1260
     gagtggcagc gcacctcgtg gaatgactcg ccaaaggaag gagagaacca aaagctcgca      1320
     cggaatctgc tagccaagtg gcttttcacg ggcgatgata gaaacacggc ccgcgtatgg      1380
     gtagctggcc gtctagtgca ttcttaccct gcctctgcaa cttaa                      1425
//

If you have problems or comments...

PBIL Back to PBIL home page