(data stored in ACNUC8465 zone)

EMBL: CU928166.PE343

CU928166.PE343       Location/Qualifiers
FT   CDS_pept        complement(668789..669409)
FT                   /locus_tag="KLTH0B08250g"
FT                   /old_locus_tag="KLTH-ORF14770"
FT                   /product="KLTH0B08250p"
FT                   /note="highly similar to uniprot|P53538 Saccharomyces
FT                   cerevisiae YNL222W SSU72 Transcription/RNA-processing
FT                   factor that associates with TFIIB and
FT                   cleavage/polyadenylation factor Pta1p exhibits intrinsic
FT                   phosphatase activity affects start site selection in vivo
FT                   Nuclear zinc-finger motif containing protein."
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08250g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21708"
FT                   /db_xref="GOA:C5DD47"
FT                   /db_xref="InterPro:IPR006811"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD47"
FT                   /protein_id="CAR21708.1"
FT                   /translation="MSNEPTKSLKFCTVCASNNNRSMESHRVLREAGYDVSSYGTGSAV
FT                   RLPGLSEDKPNVYAFGTPYNDIYNDLRSQSVERYRSNGLLEMLDRNRKLKKAPEKWQEG
FT                   FKVFDFVFTCEERCFDAVCEDLMNRGGQLNKIVHVININIRDDNENAKIGSKAILKLAD
FT                   MLSQETVRCEKTGEPLEDCIISLLAQWQEMYPQLPLLYSPAYY"
     atgtctaacg aacccaccaa gtcgctaaag ttctgcactg tatgtgcgtc taacaataac        60
     agatcgatgg agtcgcatcg agtcttgcgt gaggcaggct atgacgtctc ctcgtatggc       120
     acaggctctg cagtacgatt gcccgggtta tctgaagaca agccaaacgt ttacgcgttt       180
     gggacgcctt acaacgatat atataacgac ttgcggtccc agtcggtaga acgctaccgt       240
     tctaacgggc tacttgagat gctagatcgc aacagaaagc tcaagaaggc acctgaaaag       300
     tggcaggaag ggtttaaagt atttgatttc gtgtttacgt gtgaagagcg ctgctttgac       360
     gctgtttgcg aagacctaat gaaccgcggc gggcaactca acaagatagt acatgttatc       420
     aatataaata tccgtgacga caacgaaaac gcaaaaattg gaagcaaagc cattttgaag       480
     ctggccgaca tgctatccca agagactgtg cgctgcgaaa aaacaggcga gccgttggaa       540
     gactgcatta tctcgctgct cgctcaatgg caagaaatgt atccgcagtt gccactgctt       600
     tattcgcctg cgtactatta a                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page