(data stored in ACNUC8465 zone)

EMBL: CU928166.PE346

CU928166.PE346       Location/Qualifiers
FT   CDS_pept        673602..676454
FT                   /locus_tag="KLTH0B08316g"
FT                   /old_locus_tag="KLTH-ORF14763"
FT                   /product="KLTH0B08316p"
FT                   /note="some similarities with uniprot|P25386 Saccharomyces
FT                   cerevisiae YDL058W USO1 involved intracellular protein
FT                   transport coiled-coil protein necessary for protein
FT                   transport from ER to Golgi Integrin analogue gene"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08316g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21711"
FT                   /db_xref="InterPro:IPR021750"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD50"
FT                   /protein_id="CAR21711.1"
FT                   /translation="MLGLGSGHIYSMANQSTVSNMSKDEKYDYEDEVSDENEDSGISLT
FT                   KVRAEQGFSLRSFIDQINAKTKALAIARELDAQRGVTHQDATMSAGSIDSATSASTETQ
FT                   RTQEISSHPTATVRRIPSGARASTAEPNLGSSTPMKEVSRSDNTHNQTINDLLVQSTPI
FT                   NSSKSAPTSRNTQPRDLLKEKFMESHKAQNERSATGNADELQFENVRLREELEFYKKAH
FT                   DSQEENIQVLQETLQKQDQTAQALREKLQELQDQVEESAQALKVAQDDRRSEFEGHQRV
FT                   AEELAKCKGQIRLKEDEIVTVTENADKACQDLRTDNAGLHKKAIEIQSALTESELYVQQ
FT                   LKSKVDLMKKHNDDLSQTVHDKIEELNECNTRIDELYKENIAQENSLRSRVKEYDSELS
FT                   SLRNRNEELQKKLELQDHEFISKSSSYEARISSLKSANEDLEKGIELERTKSSKEAHVL
FT                   GDTVVTLRQQLADAEKENEKILVRFNMLEKQHLEAENLRDGLEETNQELKSVVTRLEKI
FT                   SSDQLQTIGRLEEEVERKSKKEANSLSSVRKHSKQLEEKVRHLQDVIVAKNSELEMQKQ
FT                   ELNQFESYLKSVSLFQIQAGDLIVEQYRLNKYATQMDAAFKERNPDILGFFTQDQLQTT
FT                   ENSAVRLEALDNELHKLEESIKDEWTVKVQQLEEKLKNQELKESTIAKQLAGNNIRIEE
FT                   LNSMVGTLSAEKRDLLHEKEKSMEMQQRLNDQVNSLKGELVDGEHKAFISLSNRIESLG
FT                   EERLDLQQNLQALESKIKSTETLLNEANALLNQERSEHATSQDEAAQLRKDLARLKGKA
FT                   SRKITFQMASQSRPHLSRKTYDSLMVDAVNDMDMVELQNIIKNIILLLEIPLAKITKKM
FT                   PLVGIYLRYEKNICLHFANKIHYLMFRETIDIKRYTNVAYGQYLDHHDICHLDHPLESC
FT                   LDNLYKEVSARLSLSPLTNG"
     atgcttgggc tgggcagtgg ccatatttac tcaatggcaa accagagcac agtttcgaac        60
     atgtcaaagg atgaaaagta cgattatgaa gacgaggtat cggacgagaa tgaggattcg       120
     ggaatttcgc taacaaaagt gagagccgag caaggtttca gtctaaggtc attcattgac       180
     cagataaatg ccaaaacgaa ggctctggcg attgcacgag aactcgacgc gcagcgtgga       240
     gtcactcatc aggacgcgac gatgagcgct ggatctatcg attccgcaac aagtgcctca       300
     accgaaacac aacgcacgca ggagatctct tcccatccaa ctgctactgt tcgccgaatc       360
     ccttccgggg cacgagcatc taccgcggaa cctaatcttg gctcttcgac gccaatgaag       420
     gaagtatcac gaagtgacaa cacccacaat caaacaatta atgatctcct agtgcaatcc       480
     acaccgatca attcaagcaa gtctgcacct acaagccgca acacgcagcc cagagatctt       540
     ttaaaagaaa agttcatgga aagccacaaa gcccaaaacg agaggagtgc gacgggcaac       600
     gcagatgaac ttcagtttga aaacgtgcgg ctcagggaag agcttgaatt ttataagaag       660
     gcgcacgaca gccaagaaga gaatattcag gtgttgcagg aaaccttaca gaaacaagac       720
     cagactgcac aagcgttgag ggagaaattg caagagcttc aggaccaagt ggaagaatca       780
     gcgcaagcac tcaaggttgc acaagatgat agacgctcag aatttgaagg acatcagcgg       840
     gttgcagaag aactagcgaa atgcaagggg cagataaggc tgaaagaaga tgagatagtt       900
     actgtgacag agaacgcaga caaagcatgc caagacttga gaaccgacaa tgcaggcctt       960
     cataaaaaag ctatcgaaat ccaaagcgcc ttgaccgaaa gcgaactata tgtacagcag      1020
     cttaaatcga aagttgacct catgaagaaa cataatgatg atctttcaca aactgtgcac      1080
     gataaaattg aagagctcaa tgaatgtaat acgcggattg atgagcttta taaggaaaat      1140
     attgctcaag agaactcctt gagaagcagg gtgaaagagt atgactcaga gctttcatct      1200
     ctgagaaaca ggaacgagga gcttcagaag aagctggagt tacaagacca tgagtttatt      1260
     tcaaagtcaa gttcctacga agcccgaatc tcttcgctga aaagtgcaaa tgaagacctt      1320
     gaaaaaggga tcgagttaga gaggaccaag tctagcaaag aagcacatgt tttaggagat      1380
     actgttgtga ctctcaggca gcagctcgca gacgcagaga aagagaacga gaaaattctt      1440
     gttcgtttca atatgctaga gaaacagcac ttggaagcgg aaaacctccg tgacgggttg      1500
     gaggaaacaa accaagagct taagtcagtt gttactagac ttgaaaaaat atcatcagat      1560
     cagctgcaga ccataggaag gctcgaagaa gaagtcgagc gaaagagcaa gaaagaggca      1620
     aactcccttt caagcgtaag aaaacattca aagcagctcg aggagaaggt acgacatcta      1680
     caagatgtta tcgtggccaa aaattctgaa ttagagatgc aaaaacagga gctaaatcaa      1740
     tttgagagct atctgaagtc tgtatccttg ttccaaatac aggcgggcga cctcattgtc      1800
     gaacagtatc gtctgaacaa atacgccact caaatggatg ccgctttcaa ggaacgaaac      1860
     ccagatattt taggcttttt cacccaagat cagcttcaaa caactgaaaa cagcgcagtc      1920
     aggcttgagg ccctggacaa cgaacttcat aagttggaag agtccataaa agatgagtgg      1980
     acagtgaaag tgcaacagct cgaagagaaa ttaaaaaatc aagaactcaa ggaaagtaca      2040
     atcgctaagc agctcgctgg aaataacatt aggattgaag agttgaactc gatggttggc      2100
     acattgtcag cagaaaaacg cgaccttctt cacgaaaagg agaagagcat ggaaatgcag      2160
     caaaggctta atgaccaggt gaacagtttg aaaggggagc tggtagatgg cgagcataaa      2220
     gcttttatta gcttgtccaa taggattgaa agtctaggtg aggagagact tgatctgcag      2280
     cagaatttac aggcgcttga atcaaaaatc aaatccactg aaactttgtt gaatgaagcc      2340
     aacgcgctcc ttaatcaaga gcgctctgaa catgccactt cgcaggacga ggcggctcag      2400
     ctgcgcaaag accttgcgag gctcaaagga aaagcatcga gaaagatcac attccagatg      2460
     gcatcgcagt cacgcccaca tctcagtcgc aaaacttacg actctcttat ggttgacgct      2520
     gttaacgaca tggacatggt tgaactccaa aacattatca agaacatcat tcttcttcta      2580
     gaaattcctc tcgctaagat caccaagaag atgccgctag tgggtatcta tttaagatat      2640
     gaaaagaaca tttgtctcca ctttgccaat aaaatccact acttgatgtt ccgagaaaca      2700
     attgatataa aaaggtatac caacgttgcg tatggccaat acctggatca ccatgatata      2760
     tgtcaccttg atcaccctct cgagtcatgc cttgataatc tctataaaga ggtcagcgcc      2820
     aggttgtcgt tatcaccgtt aacgaatggc taa                                   2853
//

If you have problems or comments...

PBIL Back to PBIL home page