(data stored in ACNUC8465 zone)

EMBL: CU928166.PE347

CU928166.PE347       Location/Qualifiers
FT   CDS_pept        676591..678363
FT                   /locus_tag="KLTH0B08338g"
FT                   /old_locus_tag="KLTH-ORF14762"
FT                   /product="KLTH0B08338p"
FT                   /note="similar to uniprot|P53863 Saccharomyces cerevisiae
FT                   YNL227C JJJ1 Protein that may function as a cochaperone as
FT                   suggested by the presence of a DnaJ-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08338g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21712"
FT                   /db_xref="GOA:C5DD51"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003604"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR022755"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD51"
FT                   /protein_id="CAR21712.1"
FT                   /translation="MKTCYYELLGVETTASDSDLKKAYRRKALQYHPDKNPDNVEEATT
FT                   VFATIRSAYEVLADPQERAWYDSHKQQILSDDFGAENGDDYDEYEVDAAVSGVTTDDLL
FT                   KFFNTGLYSRVDDTPAGFYQIAGKVFAKLASEEVRFGRMQGLPKFAKYQDDFFEADMGT
FT                   QGYRKAFEKYSTQETLLFPPFGDSSAGFQYLRAFYRDWSSFNTVKTFSWKDEYMYSRNY
FT                   DRRTKREIKKRNEKLRQQARSEYNKTVKRFVVFIKKFDKRMKEGAAKFEQEKRKKLQED
FT                   LRKQIEKDRLANSRDVGDPFKLQSWQTVDDLDWDEMEAYFDESKTADDAPEGSEDEVLV
FT                   YECFICNKTFKSPNQLENHNNTKSHKKMLRQIQREMHKDNMVLGLDAVSDVDEFNSADE
FT                   EFGSNAEDLQKMDELDMINAELERIQKELEEISDKGDDSLSPSDSEVPESATVGSKEGK
FT                   STLPDDQIDEEKHSFTVDDEVDSDFEISDGTKSPSASKQEEDVDELSKLLASLQGGAGE
FT                   DTESDSWDNNKKPKKKQKGKNKATSSVQPSPPPTYQCGTCSDQFTTRNTLFKHIKKSNH
FT                   AAPVKATKAKKSKR"
     atgaaaacat gctactatga gcttctcggt gtggagacga cggcatcgga ctccgaccta        60
     aagaaagcgt atcgccgaaa agccttacag tatcatcctg acaagaaccc tgataatgtt       120
     gaggaagcaa caacagtctt tgcaacaatt cggtctgcct acgaggtact tgccgatcct       180
     caggaacgtg catggtacga ctcccacaaa cagcaaatat taagtgatga ttttggcgca       240
     gaaaatggtg atgattacga tgaatacgag gtcgatgctg cagtttcggg ggtgactacc       300
     gatgaccttc taaagttttt taacacaggg ctgtattcgc gagtagatga cacgcctgca       360
     ggtttctacc aaattgcagg aaaggttttc gcgaaactgg caagcgaaga ggtccgcttt       420
     ggaagaatgc aaggcctgcc taaattcgct aagtatcaag acgacttttt cgaagcagat       480
     atgggtacac aaggctaccg caaagctttc gaaaaatact caacgcaaga aacgttgctg       540
     ttcccgccct ttggtgattc gagcgccggt tttcagtacc tgagagcgtt ttaccgcgat       600
     tggtcaagct ttaacactgt caaaaccttc agttggaaag acgaatatat gtattcgcgc       660
     aattatgata gaagaacaaa gagagagata aagaagcgga atgagaagct gcgacaacaa       720
     gcccgcagcg agtacaacaa gactgttaag aggtttgttg tcttcattaa gaagttcgac       780
     aaaagaatga aggagggtgc agccaaattt gaacaggaaa agcgcaaaaa gcttcaagaa       840
     gacctcagga agcagataga aaaggatagg cttgctaact cgagagacgt tggggaccct       900
     ttcaagctac agagctggca aacagttgac gacctcgact gggacgaaat ggaagcctat       960
     tttgatgaat ccaaaaccgc tgatgatgcg ccggaagggt ccgaggatga agttttggtg      1020
     tatgagtgct tcatctgcaa caaaacattc aagtcgccta accagcttga aaaccacaac      1080
     aacactaaaa gccacaaaaa gatgctgcgg caaatccaaa gagaaatgca taaggacaac      1140
     atggttctgg ggttggacgc cgtttcagac gttgacgagt ttaattcagc cgacgaggaa      1200
     tttggatcaa acgccgagga cctgcaaaaa atggacgagc tcgacatgat caacgcagaa      1260
     ttggagcgga tacaaaaaga attggaagaa atctccgaca agggtgacga ctccctgtcc      1320
     cctagcgatt cggaagttcc ggaatcggca acagtggggt ctaaggaggg caagtctacc      1380
     cttcctgatg accagatcga tgaggagaag cacagcttca cagttgatga tgaagtcgac      1440
     agcgatttcg agatttcaga cggaactaaa agtccaagtg cctctaaaca agaggaagac      1500
     gtggatgaac tgagcaagct actagcttcg cttcaaggag gcgcgggcga agataccgaa      1560
     tccgacagct gggacaacaa caagaaacct aagaagaagc agaagggcaa aaataaagca      1620
     acttcgtctg tccagccctc gccccctcca acctaccagt gcgggacttg ttccgaccag      1680
     ttcactacca gaaacactct attcaagcac atcaagaaaa gcaaccacgc tgctcctgtc      1740
     aaagccacta aggccaagaa atcaaaacgc taa                                   1773
//

If you have problems or comments...

PBIL Back to PBIL home page