(data stored in ACNUC8465 zone)

EMBL: CU928166.PE349

CU928166.PE349       Location/Qualifiers
FT   CDS_pept        680750..681883
FT                   /locus_tag="KLTH0B08382g"
FT                   /old_locus_tag="KLTH-ORF14752"
FT                   /product="KLTH0B08382p"
FT                   /note="some similarities with uniprot|P53861 Saccharomyces
FT                   cerevisiae YNL230C ELA1 Elongin A F-box protein that forms
FT                   a heterodimer with Elc1p and participates in transcription
FT                   elongation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08382g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21714"
FT                   /db_xref="GOA:C5DD53"
FT                   /db_xref="InterPro:IPR010684"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD53"
FT                   /protein_id="CAR21714.1"
FT                   /translation="MPISENEEEFTMEHKQTKIKSLSSLCEISLMRNHLMLQNVANVPY
FT                   RLVRNVLLKLKMEHLCKLEESNVLLIFEDEEAWVELLKKDFPMHVHDTYHRKRDEIVAF
FT                   YADFVEKHDPPKLRDEELMRGFLRFAVRKEPATHKYKVPSRMLYFKYQEDMLRKQELST
FT                   QRLRMRMQEMQQEKEKKQIVPLDDPVYCERRTKAAARAGAGERSGLFAKSYKEHQKRQL
FT                   HFKSGGYDAKSRPVKRLAFGGQVGRPAPSPAAPAPCAAPAPPVAAPAPLPATMQDTSQP
FT                   KRSTPAVAPSARRKPTPEQNLFLKRRRPLPKPKTPPTPRAEPSVKRKPTVVKVNSTKIH
FT                   RKNTKTSIFAAPSPQQQVLSQHSNTSSAYIFDQPRQG"
     atgccgatat cggaaaacga agaagagttt actatggaac acaaacagac gaagatcaag        60
     agcctcagct ctctgtgtga aatcagctta atgagaaacc atcttatgtt gcaaaatgtg       120
     gcaaacgtgc cttaccggct ggtacgaaat gtgctgttga agctgaagat ggagcacctg       180
     tgtaagttgg aggaatcaaa cgtgctgcta atatttgagg atgaagaagc ctgggtagag       240
     ctgctcaaga aggacttccc gatgcatgtg cacgacactt accaccgtaa gcgggacgaa       300
     atagtagcat tctacgctga ttttgtagag aagcacgacc cacccaaatt gcgggacgag       360
     gagctcatgc gagggtttct gcgctttgct gtgcgcaagg agcctgcgac gcacaagtat       420
     aaggtgccca gccggatgct ttatttcaag taccaagaag acatgttacg gaaacaggag       480
     ctcagcacgc agcggctgcg gatgcggatg caagagatgc agcaggagaa ggaaaagaag       540
     cagatcgtgc cgcttgacga ccccgtttac tgcgagcgac gtaccaaggc cgcagcgcgc       600
     gccggagcag gcgagcgctc aggcctgttt gcaaaatcct ataaggaaca ccaaaagcgg       660
     cagttacact tcaagagtgg cggatacgat gccaagagcc ggccggtgaa acggctggcg       720
     ttcggtggcc aggtggggag acccgcgcct agccccgccg cgccagcccc gtgcgcagct       780
     cctgctccgc ctgtcgccgc gcccgccccg cttcccgcaa caatgcagga cacctctcag       840
     cctaagagaa gcacaccagc agtcgctccg tctgcacgcc ggaagccaac ccccgaacaa       900
     aaccttttcc tgaagcgcag aaggcctctg ccgaagccca aaacgccgcc cacgccccga       960
     gcagaaccct ctgtaaagag aaagcccact gtggtcaagg tcaattccac caaaattcac      1020
     agaaaaaaca ccaaaactag cattttcgct gctccctcgc cccagcagca ggtcctgagc      1080
     cagcatagca acacctccag cgcctacatc ttcgaccagc cccgccaggg ctag            1134
//

If you have problems or comments...

PBIL Back to PBIL home page