(data stored in ACNUC8465 zone)

EMBL: CU928166.PE351

CU928166.PE351       Location/Qualifiers
FT   CDS_pept        complement(683397..684242)
FT                   /locus_tag="KLTH0B08426g"
FT                   /old_locus_tag="KLTH-ORF14746"
FT                   /product="KLTH0B08426p"
FT                   /note="similar to uniprot|P53859 Saccharomyces cerevisiae
FT                   YNL232W CSL4 Subunit of the exosome which is an essential
FT                   complex present in both nucleus and cytoplasm that mediates
FT                   RNA processing and degradation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08426g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21716"
FT                   /db_xref="GOA:C5DD55"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019495"
FT                   /db_xref="InterPro:IPR039771"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD55"
FT                   /protein_id="CAR21716.1"
FT                   /translation="MVYYAQSTHSAYPGQLICPVYELEKGTDSQQVIRYIAGAGVAEQD
FT                   YELNGQKIIALAATVVGEVKFDEELKEMVPSGEVAESNENEEEETVSTEEERHFIVSVT
FT                   DKRQDGQAVTADFANNLPREGDIVLARVTRISQQRANVEILAVENKTTPVDSGVGSNGA
FT                   GIVAAGGGSGGATFSVSQASSDLGETFRGLISSRDVRATDRDKVKIIDSFRPGDIVRAQ
FT                   VISLGDGSNYHLSTARNDLGVVFAKACNGAGGMMYAIDWKTMVAPSTGFTEARKCAKPF
FT                   "
     atggtatatt acgctcaaag cacgcactcc gcctatccag gacaactgat ttgcccggtt        60
     tacgaactag aaaaaggcac agactcgcaa caagttatca gatacattgc tggcgccggc       120
     gtagcagaac aggactacga actaaatggt cagaaaataa tagcattagc ggcaacagtc       180
     gtcggagagg tcaagttcga tgaagaactt aaagagatgg taccgagcgg cgaagttgct       240
     gagtccaacg agaatgagga agaagagaca gtaagcacag aagaggaaag gcattttatt       300
     gttagtgtga ctgacaagcg ccaagatgga caagcagtta ctgcggattt tgccaacaac       360
     ttgcccagag aaggcgacat agtcctcgcg agagttacaa gaatctcaca gcagagggct       420
     aacgttgaaa ttctggccgt ggaaaacaaa accacgccag tagattcagg ggtcggcagt       480
     aacggcgctg gcatagttgc ggctgggggc ggctcgggag gggctacttt ttcggtctcc       540
     caggcctctt ctgatcttgg ggaaacattc agaggtttaa tcagttctag agatgttaga       600
     gctacagaca gggacaaagt taagataata gatagcttca gaccaggtga catagtcaga       660
     gcgcaggtta tttcattagg cgacggttcg aattaccacc tctcgacagc gagaaacgac       720
     ttgggagttg tgtttgcgaa ggcatgcaac ggagcgggtg gtatgatgta cgcaattgat       780
     tggaaaacca tggtagcccc atctacggga ttcacagagg ctcggaaatg tgccaaacca       840
     ttttga                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page