(data stored in ACNUC8465 zone)

EMBL: CU928166.PE353

CU928166.PE353       Location/Qualifiers
FT   CDS_pept        complement(687524..688819)
FT                   /locus_tag="KLTH0B08470g"
FT                   /old_locus_tag="KLTH-ORF14740"
FT                   /product="KLTH0B08470p"
FT                   /note="some similarities with uniprot|P53857 Saccharomyces
FT                   cerevisiae YNL234W Similar to globins and has a functional
FT                   heme-binding domain involved in glucose signaling or
FT                   metabolism regulated by Rgt1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08470g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21718"
FT                   /db_xref="GOA:C5DD57"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR023950"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD57"
FT                   /protein_id="CAR21718.1"
FT                   /translation="MEENRSFYSPLDRSQIAFIPADLESISENDPSVEPSPGLPRLSGD
FT                   SHIFKESFRDSYVPSVTSQSIFSEAHPPSSLSSVDELDRLSSLSSGSSCGTNMSYAARY
FT                   KIVLKLTSREIKLIRESWSMMLNDELSGDNLRTFIRKIVHEIGGLPWVRASGRRTRNNS
FT                   QNTSLSANSSASSPGSGSPPSPKHASAIPTGNTGAFASSIFCQQFYGNLLYMAPSIEAM
FT                   FPSIRHQAVSFAGVLTMTVNNLDNLSALEAYLCALGKRHARILSIEPPHFELMGLAFLK
FT                   TIKERFGVHCTLELEETWSRLYSYLANSILQFGIDPVLKIDALKNEMIFPVLDVTKGLP
FT                   STKSMFQPLQPSALNAHALATQKLRNNSRPENISPLTKPPISSKKSLPISTSNRNISGS
FT                   ALPQQHKKEQQKPKPLGASALKRDSDKDCVIM"
     atggaagaga acagaagctt ttacagtcca ctagaccgct cacaaatagc gttcatccca        60
     gcagatctag aatccatcag cgagaatgat ccctcggtcg aaccatcacc aggactgcct       120
     aggttgagcg gggactctca cattttcaag gagtcgttca gagactctta tgtgccctca       180
     gtaacatcgc aaagtatttt cagcgaggca catcccccca gctcactgag ctctgtggac       240
     gagctggacc gcctttctag cctctcaagc ggatcctcat gtggtaccaa catgagttac       300
     gcggctcgct acaagattgt gctaaaactt acatcgcgtg agatcaagct gatccgcgaa       360
     tcttggtcga tgatgctgaa cgacgagctt tctggcgata acttgcgcac gtttattcgg       420
     aagatagtac acgagatagg tggactgcct tgggttcgtg catcaggccg aaggacccgc       480
     aacaactccc aaaacacgtc cttatccgct aattcgtccg cgtcttcccc gggcagcggg       540
     tctcctccct cccccaagca cgcctccgca attccaacag gcaataccgg cgcctttgct       600
     agctccattt tctgtcagca gttctatgga aacttgcttt atatggctcc cagcatcgag       660
     gcaatgtttc cctctatccg ccaccaggcc gtatcattcg cgggcgtttt gactatgact       720
     gttaacaatc tcgataacct ctccgctttg gaggcttacc tatgcgcact ggggaagcgc       780
     cacgcgcgca ttctctccat cgagcctcca cactttgagc tcatggggct cgccttccta       840
     aaaaccatca aggaacgctt tggcgttcac tgtactctag agcttgagga aacatggtcc       900
     agactctaca gttatttggc aaacagcatc ctgcagttcg ggattgatcc ggtgttaaaa       960
     atcgatgctc tgaaaaacga aatgatattc cctgtacttg atgtcacaaa aggtctccca      1020
     agcacaaaga gcatgttcca gcccttgcaa ccatccgccc tcaatgcaca tgcgctagca      1080
     actcaaaagc ttcggaacaa ctccaggccc gaaaacatat caccactcac aaagcctccc      1140
     atctctagca agaaaagtct tcccatttcc acatcaaacc gaaacatttc gggctctgct      1200
     ctgccacaac aacacaagaa agaacagcaa aaaccaaaac cactcggcgc gagtgcattg      1260
     aagcgcgaca gtgacaaaga ctgcgtcatt atgtaa                                1296
//

If you have problems or comments...

PBIL Back to PBIL home page