(data stored in SCRATCH zone)

EMBL: CU928166.PE362

CU928166.PE362       Location/Qualifiers
FT   CDS_pept        704855..706639
FT                   /locus_tag="KLTH0B08690g"
FT                   /old_locus_tag="KLTH-ORF14707"
FT                   /product="KLTH0B08690p"
FT                   /note="weakly similar to uniprot|P38871 Saccharomyces
FT                   cerevisiae YHR184W SSP1 Protein involved in the control of
FT                   meiotic nuclear division and spore formation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08690g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21727"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD66"
FT                   /protein_id="CAR21727.1"
FT                   /translation="MSDYYREQEQIYSKPPYLEDSSVMHSNYEMPNNERAYSRGRGFLA
FT                   DSHSFFDRVKSKLSMFRGYDSQEYLADQDSAAERQSQLWNAIKRKPIQLIVEDSMEKSQ
FT                   VAEPQQFDQAPESANTFLTDNQNDNYVRSTASPKRKDLASGVPLSGSPFASGGISDFIG
FT                   LERDAILSKNSTSWEKVTAKSPLRSATTLGTIQKRLLQISSKKNEVSKGYQKLLKELNE
FT                   WWQETIEAEENMSLISDLQQMFHEDLVFEQRLSDKLKEVSKALEFTKMREEEMLQERKE
FT                   LQHTIKKYGQMRAKKGNHSEEAHFLKEKVITKQNSLSVITGHYQQSLSTTARELFVNAS
FT                   VEYFEAASDIKDTSKTFFQNSVEYLRTVRADNIEQHIEDLRRKRADKHWSKLNAQERDD
FT                   PNRLVEIMSGMYNGQDSLMRCVERRGHMKAPEKSPANCKENQPRFDSQPDLKLEFKTGL
FT                   DESLSVFPSESAQKKDLKQTSTRSSELTEGYSKTNANGFSFDSHRTLRCEGLAGKGPSL
FT                   KTRLPYPETNETIRAPNLKLNFDNNNIRLKNLSPNAATNSEDGTLIKFPPHGENVSRFA
FT                   YEPEQDLDRNKWAESPRT"
     atgagtgact attatagaga acaagagcag atatattcaa agcctccata cctggaggac        60
     tcttctgtga tgcattctaa ttatgaaatg cccaacaacg agcgcgctta ctcccgcgga       120
     agaggcttcc tcgcagattc acatagtttc tttgatcgcg ttaaatctaa acttagcatg       180
     ttccgcggtt acgattcgca agagtacttg gcggatcaag actctgccgc tgaaagacaa       240
     agccaattgt ggaacgccat caagcgaaag ccaattcagt taatagtcga agattcaatg       300
     gaaaagagcc aagtcgcgga accacaacag tttgaccaag ccccggaaag tgcaaacacg       360
     tttctcacag ataatcaaaa tgacaattac gtgagatcca cagcttcgcc aaagaggaaa       420
     gatttggcat cgggcgttcc ccttagcggc tctcctttcg catctggagg cataagcgac       480
     ttcattgggc tcgaacgcga cgcaatcttg agtaaaaaca gtacgtcgtg ggaaaaagtc       540
     acggcgaagt caccattgag aagcgctaca acgctgggta ctatccaaaa acgactgctt       600
     cagatttcgt caaagaaaaa cgaagtttct aaaggctatc aaaagcttct gaaagagctc       660
     aatgagtggt ggcaagaaac cattgaagct gaagaaaata tgtccttaat ttcggacctg       720
     cagcaaatgt tccacgaaga cctcgttttt gagcagcggc tttccgacaa gctaaaagag       780
     gtgtcaaagg ccttagagtt taccaaaatg agagaggaag aaatgctaca agagcgcaag       840
     gaactgcagc ataccataaa gaaatatgga caaatgaggg ccaagaaagg taaccacagt       900
     gaagaagccc atttcttgaa agaaaaagtc atcactaaac aaaattcgct atcggtaatc       960
     acaggccact atcagcaatc tctaagcact accgcgagag agctttttgt caacgccagt      1020
     gtcgaatatt tcgaagctgc ttccgacatc aaagacacta gcaagacgtt tttccaaaac      1080
     tctgtcgagt acctcagaac tgttcgagca gacaacattg agcagcatat cgaggatttg      1140
     agaaggaaaa gagccgataa gcattggtcc aagctgaatg ctcaagagag ggatgacccc      1200
     aaccggcttg tcgaaatcat gagcgggatg tacaatggcc aggactcgct catgagatgt      1260
     gtggagagac ggggacacat gaaagctcca gagaagtcac ccgccaattg caaagaaaac      1320
     caaccacgct ttgacagcca accagaccta aaactcgaat tcaagacggg cctagatgag      1380
     tctttatcag ttttccctag tgagagcgca cagaaaaagg accttaagca aacctctacc      1440
     agatcctcag aactgacaga gggttactca aaaactaatg cgaatggatt ttcgtttgat      1500
     tcgcaccgca ccctgagatg cgaaggcctt gcaggaaaag gcccaagtct taaaactcgg      1560
     ctgccctacc cagaaacaaa tgaaacgatt cgagctccga acctgaagct caattttgac      1620
     aacaacaaca tccgacttaa aaacctttca ccaaatgcag caacaaactc tgaggatgga      1680
     acattgatca aattccctcc gcacggcgag aatgtatcga ggttcgcata cgagccagag      1740
     caggatctgg accgaaataa gtgggcagag tctccaagga catga                      1785
//

If you have problems or comments...

PBIL Back to PBIL home page