(data stored in SCRATCH zone)

EMBL: CU928166.PE363

CU928166.PE363       Location/Qualifiers
FT   CDS_pept        complement(706712..707746)
FT                   /locus_tag="KLTH0B08712g"
FT                   /old_locus_tag="KLTH-ORF14704"
FT                   /product="KLTH0B08712p"
FT                   /note="similar to uniprot|P53320 Saccharomyces cerevisiae
FT                   YGR257C MTM1 Mitochondrial protein of the mitochondrial
FT                   carrier family involved in activating mitochondrial Sod2p
FT                   probably by facilitating insertion of an essential
FT                   manganese cofactor"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08712g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21728"
FT                   /db_xref="GOA:C5DD67"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD67"
FT                   /protein_id="CAR21728.1"
FT                   /translation="MSNEKKEGIGLKERLLSAVAGSLLTSLILTPMDVVRIRLQQQKML
FT                   PSCDCDANGKLSLKTTAPKGVFWQDACFADVHCQTSSVNYNSTWDAFTKIARIEGARSL
FT                   WRGLSITLVMAVPANMVYFIGYESLRDNSFLQNKYSRLNPLLCGAIARVLAATTVAPLE
FT                   LFRTRLQSIPRSSPNSTAAMMVKDLIKESRYEISRVGYKALFRGLEITLWRDVPFSSIY
FT                   WGCYEFYKSNISIKSERSIVNSSNTNWNHFVNSFVGGSFGGAVAAILTHPFDVGKTRMQ
FT                   ISFLNNTPGKSPSKNMFKYLNQIRKSEGLGALYTGLVPRVIKIAPSCAIMISTYEVCKR
FT                   LFST"
     atgtccaatg agaaaaaaga aggaattggt ttgaaggagc ggctgctgag tgccgttgca        60
     ggctcattac tcacctcatt gatcttgact ccgatggacg tggtgaggat acgattgcaa       120
     cagcagaaaa tgctgccaag ttgcgactgc gacgcaaacg gcaagctctc tctcaagact       180
     acagcgccta aaggcgtttt ctggcaggac gcatgtttcg ccgacgttca ttgccaaaca       240
     agttcagtaa actataacag cacctgggat gctttcacaa aaattgcaag gattgaaggg       300
     gcaagaagtc tttggcgagg tctttccatc accctggtaa tggctgtacc cgctaacatg       360
     gtttacttca ttggttacga gtctctccga gacaattctt tcctgcaaaa taaatactcg       420
     agactgaacc ctctactgtg cggggctata gcccgtgtcc tcgctgctac tacagttgca       480
     ccgctagaac tgtttcgcac aaggttgcaa agcattcccc gttctagccc caacagcacg       540
     gccgcaatga tggtcaaaga cctgattaaa gagtcacggt acgagatatc gagagttggg       600
     tacaaagccc tattcagagg cctcgagata acgctctggc gtgatgttcc gttcagttct       660
     atttattggg gctgctacga gttttacaaa agcaatattt ctatcaagtc ggaaaggagc       720
     attgtcaaca gttccaacac taattggaac cattttgtga acagctttgt gggcggaagc       780
     tttggtggag cagtagcagc cattctaaca cacccgtttg acgtcgggaa gaccaggatg       840
     caaatatctt ttctgaacaa cacgccaggt aaaagtcctt ccaaaaatat gtttaagtat       900
     ctcaaccaga tacgcaaaag cgagggcttg ggggcgcttt acactggtct ggtaccgagg       960
     gtcatcaaaa ttgcgccaag ctgcgccatc atgatatcaa catatgaggt ttgcaagcgc      1020
     ctctttagca cataa                                                       1035
//

If you have problems or comments...

PBIL Back to PBIL home page