(data stored in ACNUC8465 zone)

EMBL: CU928166.PE366

CU928166.PE366       Location/Qualifiers
FT   CDS_pept        complement(712793..717340)
FT                   /locus_tag="KLTH0B08800g"
FT                   /old_locus_tag="KLTH-ORF14698"
FT                   /product="KLTH0B08800p"
FT                   /note="some similarities with uniprot|P38873 Saccharomyces
FT                   cerevisiae YHR186C KOG1 Subunit of TORC1 a rapamycin-
FT                   sensitive complex involved in growth control that contains
FT                   Tor1p or Tor2p Lst8p and Tco89p contains four HEAT repeats
FT                   and seven WD-40 repeats may act as a scaffold protein to
FT                   couple TOR and its effectors"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08800g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21731"
FT                   /db_xref="GOA:C5DD70"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR004083"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR029347"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD70"
FT                   /protein_id="CAR21731.1"
FT                   /translation="MPTTYGPQPLRKLNTETRHGFGDQYSSEQYLENLENDFMFYFDDK
FT                   RHRTNGNPTSPEVKAKDESHYYQPIPDWKIVKERQKTVSAALLLCLNLGVDPPDVAKTH
FT                   PCARLESWVDPLNFQDSKKAIEQIGKNLQSQYETLSLRTRYKQSLDPCVEDVKRFCNSL
FT                   RRASKDERILFHYNGHGVPQPTASGEMWVFNRGYTQYIPVSLYDLQTWLGAPCIYVYDC
FT                   NSAGNIVANFQTFVQKRIKDDQDGNHDPAAPSPTQAYTECIQLASCRANELLPMKPELP
FT                   ADLFTCCLTCPIKISVEIFLMQSPLRESKYSVLFQDYDSRTHRSGEQSSSAKPNVTIPG
FT                   KLSDRRTPLGELNWIFTAITDTIAWTSLPRPLFKKLFRHDLMVAALFRNFLLAKRIMPW
FT                   FNCHPVSDPELPDSIADHPMWKSWDLAIDEVLTKLVDDLQNVPLASADLELQPSLQEQQ
FT                   VSDTSIDDPLHSKAAAGTLSTMSLANHQAGSLSQVSQHLSQQQLLQHQHQQQQLQQQQQ
FT                   QQQFTGFFEQNLTAFELWLKYGSNTRHPPEQLPIVLQVLLSQVHRVRALVLLSRFLDLG
FT                   PWAVYLSLSIGIFPYVLKLLQSPAPELRPILVFIWARIMSIDYKNTQAELIKEKGYLYF
FT                   VKILVPELGMHPQPGSAPQLQRTISGGGLTMNASTSIGTQRYQFYQNFQNANNPGVAMA
FT                   NNTTDEQKAMAMFVLSSFLRDFSLGQKYCSSLELLGKICYYVETSDVPLLRQWCIVLMG
FT                   QLYLKNPFNKYLCMTCGFLDKIYTSMKDPIPEIRCAALLAFSMFISEKNDAEMALQMQQ
FT                   EMQQQAQQLQVQLQTLQGGQMQRQQAQAERQLQQLQASLSQMRTMDSRKLKQDEIKMTI
FT                   EALGLVNDGSPLVRKELIISLSRIVHRYINFFFVIAFNELCDEISQLESTGDSAALESK
FT                   QSIAHGSIFNTVWKSLLILAEDPYLENKTLAQQVVDYVFTKLNVHSQLNEVVLLMELYL
FT                   VKHTSCNATGHGATTVSILPTAKRPLSLSANKREATSNSETPKSGIFKRSISLNGLLKA
FT                   LGWEQDQEDSSQETPSNRSFGRLQGNNLLTVPYGVSPSATTPRYKKPKGPIDMPLKSSF
FT                   LDYSREYFQEPQMKKQEADEPGSVEYTSRLWRRNRNESIIQRTQAQKRLALYGDWSNKI
FT                   GTLDNKTQPKLLKFSQFENYIACSDDRDNISIFDWVDKSKLSTFSNGNPFGTKITDMSY
FT                   LNEDDVPLLLAGSSDGIVKIYKNFQDLEELELVSSWRGLTDLLLTPRSTGLLTEWQQSR
FT                   GSLLVTGDAKIIRVWDALTETIEVDIPAKSSSLITSITSDQLSGHMFVTGFSDGSLRAY
FT                   DRRVDPRDSMVRLWRSGDGKSNFGINNIHLQRGGYRELVSGTENGLVELWDLRYQNSIG
FT                   KFKDEGDKSSSMTTMTSMKVHEHAPVIATGTKSLKIWTTSGDLLSSFKNNTPAHAGGVA
FT                   GTLATGISASRISSSFISTMAFHPHEMILAAANSHNSSINIYECYEGKTDYLYY"
     atgccaacga cctatgggcc tcagcccctc cgtaaactca atacggaaac gaggcatggg        60
     ttcggcgatc aatattcttc ggaacagtac ctcgagaacc tagaaaatga ctttatgttt       120
     tattttgatg ataaaaggca caggaccaac ggcaacccta cttcacctga agttaaggcc       180
     aaagatgaaa gccactacta tcagcccatc ccagattgga agatagtaaa agaacgacaa       240
     aaaaccgttt ccgcagcgtt actgctgtgt ctgaatcttg gagttgatcc tcctgatgtt       300
     gccaaaacac atccatgcgc gagattggag tcctgggttg atccactcaa tttccaagac       360
     tcaaaaaagg ccattgagca aattgggaag aacctgcagt cacagtacga aactctatct       420
     ttaaggaccc ggtataagca atctttagat ccctgcgtcg aagatgtgaa aaggttttgt       480
     aactccttgc ggcgggcctc caaggatgag agaatccttt ttcattacaa cggccacggc       540
     gtccctcaac ctacggcttc tggagagatg tgggtcttta atcgcggata cacacaatac       600
     attccggtgt cactgtacga cctccagacc tggcttggcg ccccctgcat atatgtctat       660
     gactgcaaca gtgctggcaa tatagtcgcc aactttcaaa catttgtaca aaagagaatt       720
     aaagacgatc aggatggaaa tcatgaccct gcggcacctt cgcccactca ggcctacact       780
     gagtgtattc agttggcgtc ctgtagagcg aatgaattgc taccaatgaa gccagagctt       840
     ccagcagatc tctttacatg ctgcttaacc tgcccaatca aaatcagtgt tgagatcttt       900
     ctcatgcaat ctccattgag agagtccaag tattcggttc tgtttcaaga ctacgattca       960
     cgaactcata gatcaggaga gcaatcgtct tccgcaaagc ctaatgttac aattcctggc      1020
     aagctatccg ataggagaac tccactgggt gagttaaatt ggatcttcac tgcaataacg      1080
     gataccatag cctggacctc cctaccgcgc ccgctattca aaaagctttt cagacatgat      1140
     ctcatggtcg ctgctctctt taggaatttt ctccttgcaa agcgcattat gccttggttc      1200
     aattgccacc cggtttctga tccagagctt cctgattcga tagcagatca cccaatgtgg      1260
     aagtcttggg acttagctat tgacgaggtc ttaacaaaac ttgttgacga ccttcaaaat      1320
     gtgccattgg cctctgcaga cctagaactg cagccatctc tgcaagagca gcaggtatcg      1380
     gatacatcga tcgatgaccc actgcactct aaagcggctg caggcacttt aagcacgatg      1440
     tcattagcga atcaccaagc aggaagcctg tcacaggtgt cgcaacatct ctctcaacag      1500
     cagctattac aacatcagca ccaacaacag caactgcagc agcaacaaca gcagcaacag      1560
     tttacaggat tttttgagca gaacttgact gcttttgaac tctggcttaa gtatgggtca      1620
     aacacccgcc acccaccaga gcaactgcca atcgttttac aggttctgtt atctcaggtt      1680
     catcgtgttc gggcgctggt cttgctttcc cggtttttgg atttaggacc ctgggccgtc      1740
     tatctttcat tatcaattgg gatatttcca tatgtcttga agcttttaca aagccctgct      1800
     ccggaactca ggccaattct ggttttcata tgggccagaa ttatgtccat agactataaa      1860
     aacacccagg ccgagttgat taaagaaaag ggatatcttt actttgtcaa aatattagtg      1920
     cccgagttgg gtatgcatcc gcagccggga agtgcccctc aacttcaaag gactattagt      1980
     ggtggcggtt tgactatgaa tgctagcaca agcatcggaa cacagcgtta tcagttttac      2040
     caaaatttcc aaaatgccaa taatcctgga gtagccatgg caaacaacac gactgatgaa      2100
     cagaaggcca tggctatgtt tgtgctctca tccttcctac gcgacttttc cctggggcaa      2160
     aaatattgct cctcattaga acttctcggc aagatatgtt attatgttga aacgtccgat      2220
     gttccgctac tacggcagtg gtgcatcgtg ctcatgggcc aattatattt aaagaaccct      2280
     ttcaacaaat atttgtgcat gacttgcggg tttttagaca aaatctacac ctctatgaag      2340
     gatcccattc ctgagattcg ttgtgccgcg ttgttagctt tcagcatgtt catttcagag      2400
     aagaatgatg ccgagatggc tcttcagatg caacaagaaa tgcaacagca ggcacaacag      2460
     cttcaagttc agcttcaaac gttacaaggt ggtcaaatgc agcggcagca agctcaagct      2520
     gagcgccagc tgcaacaact tcaagcttcg ctgtctcaga tgagaactat ggattcaagg      2580
     aaactgaaac aagacgagat caaaatgact attgaggcct taggcttggt aaatgacggg      2640
     tcaccgttgg tgaggaaaga gctaatcatc tccttgtctc gtattgtgca ccggtacatc      2700
     aacttctttt ttgttatagc tttcaatgag ttatgtgatg agatttctca gctggagtcc      2760
     acaggtgaca gtgcagcatt agaaagcaag cagtcgatag ctcatgggtc cattttcaac      2820
     acagtttgga agtcccttct cattctcgca gaggacccct acctcgaaaa caaaactttg      2880
     gcgcaacagg tagtggatta tgttttcacc aagctcaatg tccactctca gctcaatgaa      2940
     gtggtattgt taatggaact atatttggtg aagcacacct cctgcaatgc cactggtcac      3000
     ggagcaacaa cagtatctat acttcccaca gcaaaaaggc ccctcagttt gtctgcgaac      3060
     aaaagggagg ctactagcaa ctcagaaact ccaaaatcag gtattttcaa aagaagcatt      3120
     tctttgaatg gacttctgaa agctctcggc tgggagcagg accaggagga ttcttcgcag      3180
     gaaactccct ctaaccgatc attcggaaga cttcagggca ataatctttt gactgtaccg      3240
     tatggagtat ctccttcggc gactacccca aggtacaaaa aacctaaagg ccctattgat      3300
     atgcctctga aaagcagctt tttggactac tcacgggagt actttcaaga acctcagatg      3360
     aaaaaacaag aagccgacga acctggtagt gttgagtata cctcgagact ctggcgcaga      3420
     aacagaaatg agtccataat ccagaggacc caggctcaga agagactggc actctatggg      3480
     gactggtcta acaagatcgg aacattagat aacaaaacac agccaaagct gctaaaattc      3540
     agccaattcg agaactacat tgcatgctcc gacgacagag acaatatttc gatttttgat      3600
     tgggttgata aaagcaagct ttctacgttc tcaaatggca atccctttgg taccaaaatt      3660
     acagacatga gttacctaaa tgaagatgat gtgcccctgc ttctcgcagg ctcttctgac      3720
     ggtatagtca aaatttacaa gaactttcaa gaccttgagg agctagaact tgtttcctcg      3780
     tggaggggcc ttactgactt actgttgaca ccgaggtcaa ctgggttgct aacagagtgg      3840
     cagcagagca ggggatcgct cttggtgact ggagatgcta aaataatcag agtatgggat      3900
     gccttgaccg agaccattga agttgatata cctgcgaaat cttcatcgct catcacttct      3960
     attacgtcgg accaactttc agggcacatg ttcgtaacag gtttctccga tggatctctt      4020
     cgagcatatg atcgtcgcgt cgaccccaga gattccatgg tgagactatg gagatctggg      4080
     gacggaaaat ccaattttgg gataaacaac atccacttac agaggggcgg gtaccgtgaa      4140
     ctggttagcg gaaccgaaaa tggtcttgta gaactctggg atctccggta ccaaaactca      4200
     atagggaagt ttaaagatga aggtgacaag agctcgtcca tgactaccat gacttcgatg      4260
     aaggtgcacg agcatgcgcc tgtgatcgcc actggtacta aatcgttaaa gatctggact      4320
     acttcaggtg atctgctgtc gtcctttaag aacaatacgc cagcacacgc aggcggtgtt      4380
     gctggcacac tcgccacggg aataagcgca tcaagaattt caagttcgtt tatttccacg      4440
     atggctttcc atcctcatga gatgatcctg gccgctgcaa actctcacaa ctcgagcatc      4500
     aatatctacg aatgttatga aggaaagaca gactacctgt actactaa                   4548
//

If you have problems or comments...

PBIL Back to PBIL home page