(data stored in ACNUC8465 zone)

EMBL: CU928166.PE367

CU928166.PE367       Location/Qualifiers
FT   CDS_pept        717544..718431
FT                   /locus_tag="KLTH0B08822g"
FT                   /old_locus_tag="KLTH-ORF14695"
FT                   /product="KLTH0B08822p"
FT                   /note="similar to uniprot|P38874 Saccharomyces cerevisiae
FT                   YHR187W IKI1 Subunit of the Elp4p-Iki1p-Elp6p- subcomplex
FT                   of RNA polymerase II elongator complex which is a histone
FT                   acetyltransferase iki1 mutations confer resistance to the
FT                   K. lactis toxin zymocin"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08822g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21732"
FT                   /db_xref="GOA:C5DD71"
FT                   /db_xref="InterPro:IPR019519"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD71"
FT                   /protein_id="CAR21732.1"
FT                   /translation="MASSSHNPAVLLKRVLSLRESSPFILCVDCIERSASSIVEEVSRE
FT                   VGDSATIIYVSYETNNKPRYATHFVEGTGSEARLLDTIKSYLPSKPSPRKHLVIIDTLN
FT                   LIPNNKLSQFISSMVSPSVVLLGIYHKQQPEVRPSSMENYPSSLQLLQFMATSILDCQP
FT                   ITEDAAAEEMLDSKIQKLVIPRGLNSPVFKLVLTNRRKSGRALTYSFQFDSRNHTYNVL
FT                   QEQAENENTEDDKEVFEGLTTFNLNISNRQKAARENVALPFLEAQSFNAGGAIVYEYEK
FT                   DDDYDEEDPYEDPF"
     atggcgagct cgtcacacaa tcctgcagta ctactgaaaa gagtcctgtc tctaagagag        60
     tcttcgcctt tcatcttatg cgttgactgc atagaaagat ctgcatccag tattgtggag       120
     gaggtttcga gagaagtggg tgattccgcc acgatcatct atgtgtctta tgaaacgaat       180
     aacaaaccta ggtatgcgac acactttgtg gaggggacgg ggtcagaagc taggcttttg       240
     gatactataa aatcatatct tccatcaaag ccgtcaccaa gaaagcatct agttatcatc       300
     gatacactga acctgatacc aaacaacaag ttatcgcaat tcatctccag catggtatcc       360
     ccttcggtag tcctgttggg catatatcac aagcaacagc ctgaagtcag gccgagttca       420
     atggaaaact acccatcatc actgcagctg cttcaattca tggctacatc aattctggat       480
     tgccagccga ttacagaaga cgcggctgcc gaagagatgc tggattcgaa gatccaaaag       540
     cttgttatcc ctcgaggcct caactcgcct gtctttaaac ttgtgttaac aaatcgcagg       600
     aagtcagggc gggcacttac gtacagcttc cagtttgatt ctcgtaatca cacatacaac       660
     gttttacaag agcaagcaga gaatgaaaac acagaagatg acaaagaggt gtttgagggg       720
     cttacaacct ttaaccttaa tatctctaat agacaaaaag cagctcgtga aaatgtggcc       780
     ttgcccttct tggaagctca gagcttcaat gctggaggtg caattgttta tgaatacgaa       840
     aaggatgatg attatgatga agaagaccct tacgaggacc cattttaa                    888
//

If you have problems or comments...

PBIL Back to PBIL home page