(data stored in SCRATCH zone)

EMBL: CU928166.PE368

CU928166.PE368       Location/Qualifiers
FT   CDS_pept        complement(718586..720562)
FT                   /locus_tag="KLTH0B08844g"
FT                   /old_locus_tag="KLTH-ORF14693"
FT                   /product="KLTH0B08844p"
FT                   /note="similar to uniprot|P38875 Saccharomyces cerevisiae
FT                   YHR188C GPI16 Transmembrane protein subunit of the
FT                   glycosylphosphatidylinositol transamidase complex that adds
FT                   GPIs to newly synthesized proteins human PIG-Tp homolog"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08844g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21733"
FT                   /db_xref="GOA:C5DD72"
FT                   /db_xref="InterPro:IPR007245"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD72"
FT                   /protein_id="CAR21733.1"
FT                   /translation="MRALLVLFWAFLVAKAQEVRSSIDEELLIPNETESAGSADETCIA
FT                   EDSSFGLDSGNSTSNDKEDPVEEELLNEALQKPVFFEKQDAIKYPFAEQLTLKPLPRNY
FT                   MVASFQFQMASNNLSVGQSETDFDAYRHYTVFPKAISPILEYTNTRQLHLRFTHGLWDS
FT                   ESWGQLPHKGSKSGGNGVELWAVIEADSKEIAFRHWVSLANSLSGLFCSSINFIDSERT
FT                   TYPVSSFQPQGDGGLPVFNATNGLFLIRAALANEPICTENLTPFLKLLPTRGKSGISSL
FT                   LDGHKVFDSNWHSMSLDVETTCDGNDCKYHMEELIEIVFNVPNTLARAEKPIPKPVKES
FT                   DLKCDESKPHDNFECFPLPQSKEIKFRLSELFGKQIVGSSLISESPSQICADVSDNWKA
FT                   YIDVDNMLFATDNNCFSVKENKLHDLYLESDDTTQVTPPESVPLYVSRSLTGYGQDSGG
FT                   LRTVFKNPGNESVNAIYFEALPWYMRIYLSSLKIESADGLEIEDVVRGTYYLPAIDRER
FT                   PTHLEYNLTIPANTTIALSYQFDKALLKYAEYPPDANHGFEIESAVVTVLEPVRYEMRT
FT                   ATLLLSLSTPDFSMPYNVIILTSTVMGLAFGTLFNLMVKRLVPLEEADRQASLRPGLKG
FT                   KVARMLKAFSLKRKKVDEVKKRQ"
     atgagagctc ttttggtgct gttttgggca tttctcgtgg ccaaagcgca agaggttaga        60
     tcgtcaattg atgaggaact gctaatacca aatgagactg agtcagctgg cagcgcagat       120
     gaaacatgca tcgctgaaga ttcgtctttt gggttggatt ccggaaattc cacttcgaat       180
     gataaagagg acccagttga agaagagctc ctcaacgagg cgttgcaaaa gcctgttttt       240
     tttgagaagc aagatgctat caagtacccg ttcgctgagc aactgacgct gaaaccgttg       300
     ccacgtaatt atatggtagc gtctttccag ttccagatgg catccaacaa cctttctgtg       360
     ggccaatcgg aaaccgactt cgatgcgtac agacattata ctgtttttcc taaggccatt       420
     agcccaattc tagagtatac aaacacacgg cagctgcatc ttcgattcac tcacgggctg       480
     tgggattccg agtcttgggg tcaattgcca cacaaagggt ccaagtctgg tggtaatggt       540
     gtggaactct gggcggtaat agaagccgat tcaaaagaga ttgcattcag acactgggtg       600
     tcgctggcta actccctgag cggactcttc tgctcttcca ttaacttcat tgactcagag       660
     agaactactt accctgtttc atctttccaa cctcaaggcg acggcgggct gccggtcttt       720
     aatgctacaa acggcttatt tttgatacga gcggccttgg caaacgagcc aatctgtact       780
     gaaaacctta ctcctttcct gaagctctta cctaccagag gtaaaagtgg gatttcgtcc       840
     ctattagacg ggcacaaagt ctttgattct aactggcaca gtatgtctct tgatgttgaa       900
     actacatgtg acgggaatga ttgcaaatat cacatggagg agcttattga aattgtcttc       960
     aatgtcccca acacgcttgc tcgcgcggaa aagcctatcc caaagcctgt caaggagtcg      1020
     gatttgaaat gtgacgaaag caaaccacat gacaattttg aatgcttccc acttccacaa      1080
     agtaaagaaa ttaagttccg actatctgaa ctgtttggaa aacaaattgt gggctcaagc      1140
     ttgatttcag agtccccatc tcagatttgc gcggatgtta gcgacaactg gaaggcatac      1200
     attgatgttg acaacatgct ttttgcaact gacaacaatt gctttagtgt taaagagaac      1260
     aaactgcatg atctttacct agagtctgat gacacaactc aggttacgcc tcccgagagc      1320
     gtacccctgt atgtttctcg ttctctcact ggatatggac aggacagcgg tggtttgcgt      1380
     actgttttca aaaatccagg aaacgaatct gtcaacgcca tatactttga ggcgcttcct      1440
     tggtatatga ggatctatct ctcttctttg aaaatcgaaa gcgcagacgg tcttgaaatt      1500
     gaagacgttg tgagaggtac atattatcta ccagccattg acagggagcg gcccacacac      1560
     ttggagtaca atttaacaat tcccgcaaat actacaattg cgctctccta ccaatttgat      1620
     aaagcgctgc ttaaatacgc tgaatatcca ccagacgcga accatggatt tgaaatagaa      1680
     tctgcagtgg tgactgtgct tgaaccagta aggtatgaaa tgagaactgc tactttactg      1740
     ctctcattat caaccccgga tttcagcatg ccttacaatg ttataatctt gacttcaaca      1800
     gtaatgggtc tggcttttgg gaccctgttt aacctaatgg tcaagcgcct tgttcctctt      1860
     gaggaggcag ataggcaagc ttcccttcgt cctgggctga aaggcaaagt ggctagaatg      1920
     ctcaaagcat tttcattgaa acggaagaag gttgatgaag ttaaaaaacg gcagtag         1977
//

If you have problems or comments...

PBIL Back to PBIL home page