(data stored in ACNUC8465 zone)

EMBL: CU928166.PE373

CU928166.PE373       Location/Qualifiers
FT   CDS_pept        complement(729231..731486)
FT                   /locus_tag="KLTH0B08976g"
FT                   /old_locus_tag="KLTH-ORF14681"
FT                   /product="KLTH0B08976p"
FT                   /note="highly similar to uniprot|P00958 Saccharomyces
FT                   cerevisiae YGR264C MES1 Methionyl-tRNA synthetase forms a
FT                   complex with glutamyl-tRNA synthetase (Gus1p) and Arc1p
FT                   which increases the catalytic efficiency of both tRNA
FT                   synthetases also has a role in nuclear export of tRNAs"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B08976g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21738"
FT                   /db_xref="GOA:C5DD77"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR018285"
FT                   /db_xref="InterPro:IPR023458"
FT                   /db_xref="InterPro:IPR029038"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD77"
FT                   /protein_id="CAR21738.1"
FT                   /translation="MAFNLSFDRSKDHSYALQLANNIKLALAQELAGKEIKISVNDESV
FT                   KPELTVASTDFRLFNTNAILRYVLNDFEGLESSETHFAVSSLEAMLYHPSAPQEHVKEN
FT                   VSKALENYLQELREPFCATNLITFANAYALSPESLESKFANLPASLSKALSAAKSYTPR
FT                   LSSSFKRTGAVKINSNFAVKKQDAEILPIEGERNILITSALPYVNNVPHLGNIVGSVLS
FT                   ADIYARYCKARNYNTLFVCGTDEYGTATETKAIEEGCTPRELCDKYHKIHSDVYKWFQI
FT                   GFDYFGRTTTEKQTEIAQDIFNKLNNNGYLEEHSMKQLYCEEHKAYLADRYVEGECPKC
FT                   HYEDARGDQCDKCGGLLDPFELINPRCKLDNSKPIPRNSDHIFISLDKLEPRIKEWVEK
FT                   SSREGGWSKNSRTITQSWLKEGLQPRCITRDLVWGTPVPLEKYKDKVLYVWFDATIGYV
FT                   SITANYTDGWKKWWKDPENVQLYQFMGKDNVPFHSVIFPGSQLGTNENWTMLHHLSTTE
FT                   YLQYEGGKFSKSRGVGVFGNNAKDTGVSPSVWRYYLASVRPESSDSHFSWSDFVARNNS
FT                   ELLANLGNFVNRLVKFVNAKYNGVVPEYDQKQLADFVKLEKDINSILSSYVSEMEQSHE
FT                   RRGLEIAMSLSARGNLFLQENKLDNSLFSEFPAKSDAVVGVGLNIVYSVASVIYPFMPE
FT                   AAETIYKMLNAPAKKIDDKFYLCIEGGHNINKAEYLFKRIDEKEIENWRSKYGGQQK"
     atggcattca acctatcttt cgacaggtct aaagaccata gttacgccct tcagcttgct        60
     aataatatta agttagccct tgctcaggaa ttggctggca aggaaatcaa aatctcggtt       120
     aacgatgagt cagtgaaacc cgagttgact gtcgcgagca cggactttcg ccttttcaat       180
     accaatgcga tcttgagata tgtcttaaac gacttcgaag gtttggaatc ttcagaaacg       240
     catttcgctg tttcttcttt ggaagctatg ctataccacc caagtgcccc tcaggagcat       300
     gtcaaggaaa atgtgtccaa ggcccttgaa aactacttgc aagaattgcg ggaaccattt       360
     tgtgctacaa atttgatcac ttttgccaat gcatatgcct tgagtccaga atccttggaa       420
     tcgaaatttg caaacctgcc tgcttctttg tccaaggctc tttcagctgc caaatcgtac       480
     actccacgtc tgtcatcaag ctttaagcgt actggagctg tcaaaattaa cagtaacttt       540
     gctgtcaaga agcaggatgc agaaattttg cccatcgagg gagaaagaaa tattctcatc       600
     acatccgctt taccatacgt taacaatgtt cctcacttag gcaacatcgt tggcagtgtt       660
     ttgtctgctg atatctatgc ccgttactgc aaggctagaa actacaacac tttgttcgtt       720
     tgcggtacag atgaatatgg taccgctacc gagactaagg caattgagga gggatgtacc       780
     ccacgcgagc tatgtgacaa ataccataag attcacagcg atgtctacaa gtggttccaa       840
     atcggatttg actactttgg aagaacaaca acggaaaagc agactgagat cgcccaggac       900
     atctttaaca aactaaacaa caatgggtac ttagaagagc attctatgaa acagctttac       960
     tgcgaagagc acaaggctta cttagccgac agatacgtcg agggtgagtg tccaaaatgt      1020
     cattacgagg atgcccgcgg tgaccaatgt gacaagtgcg gcgggttgct agacccattc      1080
     gagctcatta acccacgttg taaacttgac aacagcaagc ctatccctcg taactctgat      1140
     catatcttca tttctctaga taaattggaa ccaaggatca aggagtgggt ggaaaagtcg      1200
     tccagggagg gcggatggag caaaaactcc agaaccatta cccagtcttg gttgaaggaa      1260
     ggcctgcaac ctcgttgtat cacaagagac ctcgtgtggg gtacgccagt gcctctcgaa      1320
     aagtacaaag ataaagttct ctatgtttgg ttcgatgcta ccatcgggta tgtttcgatc      1380
     accgctaact acactgacgg ctggaagaaa tggtggaagg accctgagaa cgttcagctg      1440
     taccaattca tgggcaaaga caatgttccg ttccactccg tcattttccc tggatcgcaa      1500
     ttaggtacca acgagaactg gaccatgctt catcatttaa gcaccactga gtacttgcag      1560
     tatgagggcg gcaagttttc gaagagtaga ggcgtgggag tctttggcaa caatgcaaag      1620
     gatactggtg tttcccccag tgtgtggaga tattatttgg cctctgtgag acctgaatcc      1680
     agtgactctc acttttcatg gagcgacttt gttgctagaa ataacagtga gcttttggcc      1740
     aaccttggta actttgtgaa cagactggtc aagttcgtca atgccaagta caatggtgtc      1800
     gttcctgaat atgatcaaaa gcagttggcg gacttcgtca aattggagaa ggacataaac      1860
     tctattttaa gcagctacgt ttccgaaatg gaacaatccc acgaaagacg tggtttggag      1920
     attgctatgt ctctaagtgc ccgtggtaac ttgtttttgc aagaaaacaa gcttgacaac      1980
     agtcttttct cggagttccc tgctaaatct gacgctgttg ttggtgtggg tctcaacatt      2040
     gtttactccg tggcctctgt gatctaccca ttcatgccag aagctgccga aactatctac      2100
     aagatgttga atgcaccagc taagaagatt gacgacaaat tctacctatg catagaaggc      2160
     ggacacaaca tcaacaaggc agagtacctc tttaaacgta ttgatgaaaa agagattgag      2220
     aactggagaa gcaagtatgg tggccagcaa aagtga                                2256
//

If you have problems or comments...

PBIL Back to PBIL home page