(data stored in SCRATCH zone)

EMBL: CU928166.PE379

CU928166.PE379       Location/Qualifiers
FT   CDS_pept        join(741971..741992,742080..742474)
FT                   /locus_tag="KLTH0B09108g"
FT                   /old_locus_tag="Klth0B.mRNA.688.p"
FT                   /product="KLTH0B09108p"
FT                   /note="similar to uniprot|Q03554 YMR292w Saccharomyces
FT                   cerevisiae GOT1 evolutionarily conserved non-essential
FT                   protein present in early Golgi cisternae that may be
FT                   involved in ER-Golgi transport at a step after vesicle
FT                   tethering to Golgi membranes"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09108g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21744"
FT                   /db_xref="GOA:C5DD83"
FT                   /db_xref="InterPro:IPR007305"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD83"
FT                   /protein_id="CAR21744.1"
FT                   /translation="MWLTESQKFGVAFTFGGCLFFLFGVLTFFDRALLALGNILFLVGV
FT                   LLIIGPQKTYTFFTRPSKRRGSFFFCLGILMILLKWTFMGFIVESLGIVGLFGDFFAVI
FT                   VQFLRSLPLIGPVLSHPAVAPYVDKIAGVRVLPV"
     atgtggctaa ctgagtctca aaaattcggc gtcgcgttca cttttggtgg atgcctcttc        60
     tttttgttcg gcgtgctaac gttttttgac cgcgcgctac tggctctcgg taacattcta       120
     ttcctggtgg gcgtgctgct aatcataggc cctcagaaga catacacgtt cttcaccagg       180
     ccgagcaaga gacgtggctc cttcttcttt tgtttgggca tactgatgat cctgctgaaa       240
     tggacattta tgggattcat agtagagtct ctcgggatcg tcggcctctt cggtgacttc       300
     ttcgcggtca tcgtccagtt cttgcggtcc ctacctctga tagggcccgt cctttcacac       360
     cctgcagtag caccctacgt cgacaagatc gcgggcgtga gagtactccc cgtgtga          417
//

If you have problems or comments...

PBIL Back to PBIL home page