(data stored in ACNUC8465 zone)

EMBL: CU928166.PE380

CU928166.PE380       Location/Qualifiers
FT   CDS_pept        742805..746806
FT                   /locus_tag="KLTH0B09130g"
FT                   /old_locus_tag="KLTH-ORF14657"
FT                   /product="KLTH0B09130p"
FT                   /note="similar to uniprot|P40340 Saccharomyces cerevisiae
FT                   YGR270W YTA7 Protein of unknown function member of
FT                   CDC48/PAS1/SEC18 family of ATPases potentially
FT                   phosphorylated by Cdc28p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09130g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21745"
FT                   /db_xref="GOA:C5DD84"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036427"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD84"
FT                   /protein_id="CAR21745.1"
FT                   /translation="MTRPLRPRHHEPLKNELDESSRGIKDENGIIHTTTRSLRKVNYAD
FT                   VENNYDFIDEVVDEDDEDEAAAPAGSRRRGHAIKSDSEEFEPAEKTEDEPEPPIEDHTA
FT                   QEVSGPETRNSKSRGGPDEDGDESFHEEDAEDEDEDALAGSEDEYLSEESIRRSRRRAD
FT                   RNFVVSDEDDEDEDTIGASKRTRRGYRTTTTIDTDEDDPPSRRNFRSSTIQARQGRRSE
FT                   ISPPRKLRRRARSAYGSEERQSRSDRLSLADELRELRDDSPVREKRSLRERTKPVNYTL
FT                   PPPIGDTAMDETAKLGNANGILPYPSPKARRGLHAGQSFGPLRRLFPTGGPFGGNDVTA
FT                   IFGTNTNYYDNAGQGTANNKLLLDSDSSEDEILPLGAVSTKPNESTHKKKKPEIADLDP
FT                   LGVDMNIKFEDVGGLDNYIDQLKEMVALPLLYPELYQKFGITPPRGVLFHGPPGTGKTL
FT                   MARALAASCSTEQQKITFFMRKGADILSKWVGEAERQLRLLFEEAKKQQPSIIFFDEID
FT                   GLAPVRSSKQEQIHASIVSTMLALMDGMDNRGQVIVIGATNRPDAVDPALRRPGRFDRE
FT                   FFFPLPDLSARSKILEIHTKKWDPPLPKPFIDRLASLTKGYGGADLRALCTEAALISIQ
FT                   RKVPQIYQSEMKLSINLASVNVKARDFMMALEKIVPSSARSAGNSAQPIPETVEALLDS
FT                   QFEEIKKKLKSIIPSDSKFQRNGASTIKHYLEYEVEDSDEESDGFSKAEFLRNMEKARV
FT                   CKPRLIVTGSRGNGQQYVGAAILHYLEDFNMQMLDVGTLASDSTRSFETAIVQIFTEAR
FT                   RRQPSVLYIPNSEIWLQAVPENAILMLASLLRSLRSDEKVLLLAVANGLSKSDILEGSL
FT                   SHLEFEKFIHKIRKPSSSQRAKYFLSLKQILKTKPSSFEQGKKRTKPLPQLPVVESSKK
FT                   SEGLDKNGNPLSEEAKLIQTLKSFQNHDMKLKNTLKLKLSGLMDLFKNRYKRFRKPPID
FT                   DALLIHLFETNAALQGNPDYQPAYIKENNMILECATGRRFFNMDLDIVEERLWNGFYSE
FT                   PRQFLKDIELIYKDAHTSGDRERIIKASEMFVNAQMGIEEISAPDFVMECRDSRQRELT
FT                   RQKLNLEKQAKLKSQELSEELQVRANEVDISENDLSSSSEKFERNSLNGSHALQVGVGS
FT                   GGQLQCQAQKNPQEELQVEDATNDEQGNNTERQLPNDDINPLQIGNNEYKKDDAEAAEI
FT                   EGAIDGKHAESETPRNSSPENSKSSEQSSLSEEALIEEGGPQVAEFILDDNKLNDLLSL
FT                   LEHRSEGFTVQKLEELYAFALNIIWEDRLLWDRTTTLHKLLTHIENWGN"
     atgactcgcc ctctaagacc gcgtcaccat gagcctttga aaaacgagct tgacgaatct        60
     agcagaggga tcaaagacga gaacgggatc atccacacta ctaccaggag tctccggaag       120
     gtcaattacg ctgatgtcga gaacaattac gactttatcg acgaggtagt cgatgaggac       180
     gacgaggacg aggccgcggc tccggcgggg agccggcgga gaggccacgc tataaagtcg       240
     gacagcgagg agttcgagcc cgccgagaaa actgaggacg aaccagagcc gcctattgaa       300
     gaccatacgg cgcaagaagt gagcggcccc gaaaccagga attccaaatc cagaggcggg       360
     cctgatgaag acggagacga aagctttcac gaagaggatg ctgaggatga ggacgaagac       420
     gccttggcgg gatccgagga cgaatactta tcagaggaat cgatccggag gagccgtcgt       480
     agggccgacc gaaactttgt cgtgagcgat gaggacgacg aagatgaaga caccattggg       540
     gcctccaaac ggacaaggcg aggctacaga accaccacaa ccattgatac ggacgaagac       600
     gacccgcctt ctcgcaggaa ttttcggagc tccacaatcc aggcccggca aggcagaaga       660
     agcgagattt cgccaccaag gaaattgagg cgaagagcca ggtctgctta tggaagcgaa       720
     gagcgccagt ctcggagcga ccggttatca ctcgctgacg agctccggga gttgagagat       780
     gacagccctg ttagagaaaa gaggtctctg agagagagaa cgaagcctgt gaactacaca       840
     ttgccaccac caattggaga cactgcaatg gacgaaacag cgaagcttgg caacgcgaac       900
     ggaatactac catacccctc tccaaaagcg cgccgtggct tgcacgcggg gcagagtttc       960
     gggccattga ggcgattgtt tcctactgga ggccctttcg gcggcaatga tgttacagcg      1020
     attttcggca cgaatacgaa ctattatgat aacgccgggc agggaactgc caacaacaag      1080
     cttctactag attccgattc ttcagaagac gaaatcctgc cgttgggagc ggtgtcaacg      1140
     aagcctaacg aaagtactca caagaagaaa aagccagaaa tagctgatct agatccactc      1200
     ggggttgata tgaacattaa gtttgaggac gttggtggtc tagacaacta cattgaccaa      1260
     ctgaaagaaa tggtcgcact ccccttgctt tacccagaac tgtatcagaa gtttggcatc      1320
     acacctccga gaggcgtact gtttcacggc ccaccgggta ccggtaagac tttgatggcg      1380
     cgtgctctcg cagcaagctg ctctactgaa caacaaaaaa ttacattttt tatgagaaag      1440
     ggagctgaca tcttatcaaa atgggttggt gaagctgaga gacaactgag acttttattc      1500
     gaagaggcaa aaaagcagca gccgtcaatc attttttttg atgagattga tggtttggcc      1560
     ccagtccgaa gttctaagca ggagcagatt catgccagca ttgtatcaac tatgttggcc      1620
     ctcatggacg gcatggataa tagaggccaa gttatcgtga taggtgctac aaataggccg      1680
     gacgcagtcg atccagctct gcggaggcct ggaagattcg atagagaatt cttttttcca      1740
     ttgcctgatt tgagcgcccg ttccaagatc ttggaaattc atacaaaaaa atgggatccc      1800
     cctcttccta agcctttcat cgacaggttg gcgtcgctga cgaaaggtta cggtggtgct      1860
     gacctccgag ccctctgtac agaggctgct cttataagca tacaacgtaa agttccacaa      1920
     atctatcagt ctgagatgaa gctaagcata aatttggctt cagttaatgt gaaggctcgc      1980
     gacttcatga tggcattaga aaagattgtt ccttcctcgg caagatccgc tggaaactct      2040
     gcacaaccaa tacctgaaac agtggaagca ttacttgaca gccagttcga ggaaataaaa      2100
     aagaagctca aatcaataat acctagcgat tcaaaatttc agcgcaatgg agcttccact      2160
     ataaaacact acttggagta tgaagtcgag gactctgacg aagagagtga tggcttctca      2220
     aaagctgaat ttttgaggaa tatggaaaag gcgcgtgtat gcaaaccccg tttaattgtt      2280
     acagggagta gaggtaatgg gcagcaatat gttggagctg caatcctcca ttatttggag      2340
     gattttaata tgcaaatgct tgatgtcggg actttggcca gtgatagcac gcgaagtttc      2400
     gagacagcaa ttgttcaaat ctttacagaa gccaggaggc gtcagccctc cgttttgtat      2460
     atccctaatt ccgaaatatg gcttcaagct gtcccagaaa atgcaatttt gatgctggcg      2520
     agcttgttga gatcactgag aagcgatgaa aaagtgcttc ttctagctgt tgccaatgga      2580
     ctcagtaaat cagacatcct tgagggatcc ttgtctcacc tagagttcga gaaattcatt      2640
     cacaaaattc ggaagccttc ctcttctcaa agagccaaat attttttgtc gctcaaacaa      2700
     attttgaaga cgaagccttc aagctttgaa cagggcaaaa agaggactaa gccactgcct      2760
     caacttccag tggtagaaag ctccaaaaaa agcgaaggtc tcgataaaaa tggcaatcct      2820
     ctctctgagg aggcaaaact aattcaaact ctgaaatctt tccagaacca cgacatgaag      2880
     cttaaaaata ctctcaagct gaagctgtcg ggattgatgg atctcttcaa gaatcggtac      2940
     aagaggttca gaaaaccacc gatagacgac gcgttgctca tccatctatt tgaaacgaat      3000
     gccgcattac aaggcaaccc tgactaccaa cctgcgtaca tcaaagaaaa taatatgatt      3060
     ttggagtgcg ctactggaag acgctttttc aatatggacc tggacattgt tgaagaacgc      3120
     ttgtggaatg ggttttactc tgaaccgcgc caatttctca aggacattga attgatttat      3180
     aaagacgctc acacgagcgg agatcgcgaa cgtataataa aagcttcgga aatgttcgtc      3240
     aatgcacaaa tggggattga ggagatatct gctccagact ttgttatgga gtgccgtgat      3300
     tcgcgtcaaa gagagctcac tcgtcaaaaa ctcaatcttg aaaaacaagc gaagctgaaa      3360
     tcacaggagt tgagcgaaga acttcaggta cgcgcgaatg aggtcgatat ttcagaaaat      3420
     gacttatctt cgagttcaga aaaatttgag cgaaacagct taaatggaag ccatgctctt      3480
     caagtcggcg ttgggtctgg aggtcagctt caatgccaag ctcagaagaa ccctcaagag      3540
     gaactacagg tcgaagatgc cacaaatgat gaacagggta ataataccga gagacagctt      3600
     cctaatgatg atatcaatcc cctacaaatc ggaaataatg aatacaaaaa agatgatgcc      3660
     gaagctgctg aaattgaagg tgccattgat ggaaaacacg cggaaagcga aactccaaga      3720
     aacagctcgc ctgaaaacag caaaagtagc gagcagagct cactctctga agaggcatta      3780
     atcgaagaag ggggtcctca agttgcagaa ttcatactgg atgataataa gttgaatgac      3840
     ctcttatctt tgttggaaca caggtctgag ggattcacag tgcaaaagct tgaagaattg      3900
     tacgcatttg cactgaatat catctgggag gatagattgc tctgggatag aacaaccact      3960
     ttacataaac tccttactca tattgaaaac tggggaaact aa                         4002
//

If you have problems or comments...

PBIL Back to PBIL home page