(data stored in ACNUC8465 zone)

EMBL: CU928166.PE385

CU928166.PE385       Location/Qualifiers
FT   CDS_pept        complement(756449..757042)
FT                   /locus_tag="KLTH0B09240g"
FT                   /old_locus_tag="KLTH-ORF14642"
FT                   /product="KLTH0B09240p"
FT                   /note="similar to uniprot|Q03559 YMR295C Saccharomyces
FT                   cerevisiae Protein of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09240g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21750"
FT                   /db_xref="InterPro:IPR018809"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD89"
FT                   /protein_id="CAR21750.1"
FT                   /translation="MGLFRKSSNASTGAGHLHAPDTKLTKEDREHFKLRASSVHDPVLE
FT                   AVQEAQPFEQAADVSQDDPNRKSYYSGDGPDHLTRDVFGQPIQQPDISNPMRARDERPL
FT                   DTIRGFEYSISGDPSWGQRLETHQYGFRVRPDFPQFGNSGDAMAASGPGGMPSSQFMMQ
FT                   EQAIYSAPAPGSALNPSKKKKKRGLFGRKKDTAE"
     atgggactct tcagaaagtc cagcaacgca tccacgggtg ctggccatct acacgcgcca        60
     gacacgaagc ttaccaagga agaccgcgag cacttcaagc tcagagcctc ctcggtgcac       120
     gaccccgttc ttgaggccgt gcaggaggcc cagcccttcg agcaggccgc ggacgtgtcg       180
     caggacgatc cgaaccgcaa gtcgtactat tccggcgatg gccccgacca tctaacgcgc       240
     gacgtcttcg ggcagcccat tcagcagccc gacatctcga accccatgcg cgcgcgtgac       300
     gagcgtccgc ttgacaccat tcgcggattt gagtactcca tttctggcga cccatcctgg       360
     ggtcagcgtc tcgagacgca ccagtatggc ttccgcgtaa ggcccgactt tccacagttt       420
     ggcaactcgg gcgacgcaat ggccgccagt ggccctggcg gtatgccctc ctcgcaattt       480
     atgatgcagg agcaagctat ctactcggcg ccggcgccgg gctccgcttt gaatccttcc       540
     aaaaagaaga agaagcgtgg cctgtttggc cgcaagaaag acaccgctga atag             594
//

If you have problems or comments...

PBIL Back to PBIL home page