(data stored in SCRATCH zone)

EMBL: CU928166.PE389

CU928166.PE389       Location/Qualifiers
FT   CDS_pept        765494..767071
FT                   /locus_tag="KLTH0B09328g"
FT                   /old_locus_tag="KLTH-ORF14621"
FT                   /product="KLTH0B09328p"
FT                   /note="similar to uniprot|P00729 Saccharomyces cerevisiae
FT                   YMR297W PRC1 Vacuolar carboxypeptidase Y (proteinase C)
FT                   involved in protein degradation in the vacuole and required
FT                   for full protein degradation during sporulation"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09328g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21754"
FT                   /db_xref="GOA:C5DD93"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR008442"
FT                   /db_xref="InterPro:IPR018202"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR033124"
FT                   /db_xref="UniProtKB/TrEMBL:C5DD93"
FT                   /protein_id="CAR21754.1"
FT                   /translation="MKTSTLLAGALAASAQAASVQNVFQANTLLDKAIDALGLSSEDVL
FT                   DSLPKSLKSVWGEMGMLFPKETSQLEFVTKPKFKTNRRPDSQWDFVVQENPSHKLRVNK
FT                   IKDPQVLGVDPGVKQYTGYLDVEEEDKHFFYWFFESRNDPKNDPVILWLNGGPGCSSLT
FT                   GQFFELGPSHIGPEIKPIYNPYSWNSNASVIFLDQPVNVGYSYSGSSGVSNTVAAGKDV
FT                   YAFLQLFFKQFPEYASGQDFHIAGESYAGHYIPVFASEILSHPEEERSFNLTSVLIGNG
FT                   LTDELTQYQYYEPMACGEGGEPSVLEPEECEGMLDTLPRCLSLIEACYDSQSVWTCVPA
FT                   SIYCNNAQMGPYQKTGKNVYDIRKECEGELCYAEMSYMDEYLNLDVVKEAVGAEVDKFE
FT                   SCNFDINRNFLFAGDWMKPYHKAVTDLLNQGLPVLIYAGDKDFICNWLGNQAWSNVLPW
FT                   KYGDEFQDAPVKDWISSTTGDTAGKVKNYEHFTFLRVYGGGHMVPYDQPENSLAMVNDW
FT                   IQGRYSFE"
     atgaagactt cgacccttct tgcgggcgct ttagcagcct ccgcacaggc tgcctcggtt        60
     caaaacgtgt tccaggcgaa caccctgctc gataaagcca tcgatgcgct aggactatcg       120
     tcagaggacg tcctagactc gctgcctaag agccttaaaa gcgtgtgggg cgagatgggt       180
     atgctgtttc ccaaagagac ttcgcagctc gagttcgtga ccaagcccaa gttcaagact       240
     aaccgtcgtc ctgatagcca gtgggatttt gttgtgcagg agaacccctc gcacaaactg       300
     cgtgtcaaca agatcaaaga cccccaggta ttgggagtcg accctggcgt caagcagtac       360
     acaggttacc ttgacgttga ggaggaagac aagcacttct tctactggtt tttcgagagt       420
     agaaatgacc caaaaaatga ccctgtcatc ctgtggctga acggtggacc cggctgctct       480
     tctttgactg gccagttctt tgaacttgga ccctctcaca ttggccccga aatcaagccc       540
     atctacaacc catactcttg gaactcgaat gcgtctgtca ttttccttga ccaacctgtc       600
     aacgtggggt actcttactc cggctcgagc ggtgtgtcta acactgttgc tgcgggcaag       660
     gacgtctacg cctttttgca actgttcttc aagcaattcc cagaatacgc ctctggccaa       720
     gacttccaca tcgcgggcga atcctatgca ggccactaca ttcctgtttt cgcttctgag       780
     atcctatcgc acccagagga ggagagatcc ttcaatctga cttctgtttt gatcggaaac       840
     ggtctcacag acgaactcac ccagtatcaa tactatgaac caatggcctg tggtgaaggt       900
     ggcgaaccat ccgtgcttga gcctgaagaa tgtgaaggga tgctcgacac cttgccccgt       960
     tgtctgtctt tgatcgaggc ctgctacgac tctcaatctg tttggacctg cgttcctgca      1020
     tcaatctact gtaacaacgc gcagatggga ccttaccaga agacagggaa aaatgtttat      1080
     gacatccgca aagagtgcga gggcgagttg tgttacgccg aaatgtctta catggacgag      1140
     tacctcaacc ttgacgtcgt aaaggaggcg gttggcgctg aggttgacaa gtttgagtca      1200
     tgcaacttcg atatcaacag aaactttttg tttgcaggtg actggatgaa gccataccac      1260
     aaggccgtga cagacctttt gaaccaggga ttgccagtcc ttatttatgc aggcgacaaa      1320
     gactttattt gcaactggct tggtaaccag gcctggtcga acgttttgcc ttggaaatac      1380
     ggagacgagt tccaagacgc gcctgttaag gactggattt cgagcaccac aggagacacc      1440
     gctggtaaag tcaagaacta tgaacacttc actttcttaa gagtctatgg cggtggtcac      1500
     atggttccat acgaccagcc tgagaactct cttgcaatgg ttaacgactg gattcagggc      1560
     cgctactctt ttgagtaa                                                    1578
//

If you have problems or comments...

PBIL Back to PBIL home page