(data stored in SCRATCH zone)

EMBL: CU928166.PE39

CU928166.PE39        Location/Qualifiers
FT   CDS_pept        102227..103960
FT                   /locus_tag="KLTH0B01166g"
FT                   /old_locus_tag="KLTH-ORF15855"
FT                   /product="KLTH0B01166p"
FT                   /note="similar to uniprot|P53388 Saccharomyces cerevisiae
FT                   YPL265W DIP5 Dicarboxylic amino acid permease mediates
FT                   high-affinity and high-capacity transport of L- glutamate
FT                   and L-aspartate also a transporter for Gln Asn Ser Ala and
FT                   Gly"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01166g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21404"
FT                   /db_xref="GOA:C5DC93"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004762"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC93"
FT                   /protein_id="CAR21404.1"
FT                   /translation="MSESLEKKNAGILYSNETLEEDVAFDKLERGASGASAAGASVDGK
FT                   HEGIRLKKALEARHVSMIAIGGSLGTGLLIGTGSSLASAGPASILISYSFVGLLVYTVM
FT                   ACLGEMAAFIPLDGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWVS
FT                   REKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGP
FT                   NHDRTGFRYWRDPGAFKPYSEAISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKN
FT                   PRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIKAKKMSTSAAASPFVVAIKN
FT                   AGIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSL
FT                   AVSVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKS
FT                   GFSYTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGY
FT                   KLVHRSKLIKPEDVDLYTFKAAIDAEEEEGKLLELERKEQLKSSPKNLTWFYDTFLGWI
FT                   F"
     atgtccgagt ctctagagaa gaaaaatgct gggatattat acagcaacga gacccttgag        60
     gaggatgtcg cctttgacaa actcgagcgc ggcgccagcg gcgccagcgc cgcgggcgcg       120
     tctgtggacg gcaaacacga aggcatccgg ctgaagaaag cgcttgaggc gcggcacgtg       180
     tcgatgatcg ccatcggcgg gtcgcttggt accgggctgt tgatcggcac aggtagctct       240
     ctggccagcg cgggccctgc gtcaattttg atttcgtaca gtttcgtggg cctgttggtg       300
     tacacggtga tggcgtgtct cggagagatg gccgcgttta ttccgctgga cggcttcaca       360
     tcgtacgcgt cgcgttacgt cgaccccgcg ttgggcttcg cagtcgggta ctgctacctg       420
     ttcaagtatt tcattgtgac gcccaatcag ctgaccgcag gcgccatggt gatgcagtac       480
     tgggtctcgc gtgaaaaggt caacccgggc gtgtggatca cgattttcct tgttctcatt       540
     gtgctcatca acacggtcgg tgtgcgcttc ttcggcgaat tcgagttctg gctgtccagt       600
     gtcaaggtcc tggtcatgct ggggctcatc ctgctgctgt ttatcatcat gctcggtggc       660
     gggcccaacc acgaccgcac cggcttccgc tactggcgcg accctggtgc gttcaagccc       720
     tactccgaag ccatctcggg ctccaagggc aagttcgtgt cttttgcttc cgtgttcgcg       780
     ctcgccttgt tcgcttacac cggtaccgag ctgtgtggta tcgtcgccgc cgaggctaag       840
     aacccacgtc gcagtgtgcc ccgcgccatc aagctgaccc tctaccgtat cgtgctcttc       900
     tacgtcatct ccattctgtt gctaggaatg accgtcgcct acaacgaccc actactgatc       960
     aaggccaaga agatgtccac ctccgcggct gcctcgcctt ttgttgtggc tatcaagaac      1020
     gctggcattc ctgtcctgcc tcacatcttc aacgcttgtg tgctgctctt tgttttcagt      1080
     gcctgtaact cagaccttta cgtcgcctcc agaacccttt acggtctggc catcgaccgc      1140
     aaggctccaa aaatctttgc caagactaac ggctggggtg tgccatacta ctcgctcgcg      1200
     gtctctgtcc tgttctgtct ccttgcgtac atgaatgtct cctcaggttc cgctcagatc      1260
     ttcaactact tcgtcaatgt cgtcagtatc tttggtctgt tgagttggat ctccatcctt      1320
     atcacctacc tgcgtttcca caaggctgtc atcgcccaat tcggcgacaa gtctggtttc      1380
     tcttacacgg caccattcca accttggtct acctgggtgt ccttgttctt ctgctgcctc      1440
     atcggtctca tcaagaacta cacggtgttt ctgggccaca cgtttgacta caaaaccttc      1500
     atctccggtt acatcggcat ccctgtctac gctatctgct acgtgggcta caaattggtg      1560
     caccgctcga agctaattaa accagaggac gtcgacctct acacattcaa agctgcgatc      1620
     gacgcggagg aagaagaagg taagctgctc gagctcgagc gcaaagaaca gctcaaaagc      1680
     tctccaaaga acctcacatg gttttacgac acctttttgg gctggatttt ctaa            1734
//

If you have problems or comments...

PBIL Back to PBIL home page