(data stored in ACNUC8465 zone)

EMBL: CU928166.PE397

CU928166.PE397       Location/Qualifiers
FT   CDS_pept        complement(779619..780320)
FT                   /locus_tag="KLTH0B09504g"
FT                   /old_locus_tag="KLTH-ORF14602"
FT                   /product="KLTH0B09504p"
FT                   /note="highly similar to uniprot|P40302 Saccharomyces
FT                   cerevisiae YMR314W PRE5 20S proteasome alpha-type subunit"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09504g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21762"
FT                   /db_xref="GOA:C5DDA1"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR023332"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035144"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDA1"
FT                   /protein_id="CAR21762.1"
FT                   /translation="MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGVRSKKFAV
FT                   LVALKRNADELSSYQKKIIKCDEHLGLSLAGLAPDGRVLSNFLRQQCNYSSLVYNRKLS
FT                   LEKAGNLLSDKAQKNTQSYGGRPYGVGLLLAGYDNSGPHLLEFQPSGNTLELYGSAIGA
FT                   RSQGAKTYLERTLQDYLELDDADDLIRVAVEALRQCLKDEVLSTKNLSIAVVGQDKPFT
FT                   ILDDEAVSPYL"
     atgttcagaa acaactacga tggtgatact gtgacttttt cacccacagg aaggcttttc        60
     caggttgaat acgcactgga ggctatcaag cagggtagtg tgacagtggg cgttcggtcc       120
     aagaagtttg cggtattagt ggcgctcaag cgtaatgccg atgaactctc ctcttaccag       180
     aagaagatca tcaagtgcga tgagcactta ggtctttccc ttgccgggtt ggcgccagac       240
     ggacgcgtgc tcagcaactt tctaagacag caatgcaact actcgagtct tgtatacaac       300
     cgcaagctat cattagagaa ggcaggcaac ctgctcagcg acaaggccca aaagaataca       360
     caatcgtacg gcggaagacc ctatggtgtg ggactcttgc ttgccggcta cgacaacagt       420
     ggcccacatt tgcttgagtt ccagccttca ggaaacactc tcgaactcta cggctctgcc       480
     atcggtgcgc gttctcaagg cgcgaagacg tatttggaga gaacccttca agattatttg       540
     gaattggatg acgccgacga tctgattcgc gttgcagtag aagccctcag gcagtgtttg       600
     aaggatgagg ttttgagtac caagaacctt tctatagcgg ttgtgggcca agataaacct       660
     ttcacaattt tggacgacga agcagtgtcg ccatatctat aa                          702
//

If you have problems or comments...

PBIL Back to PBIL home page