(data stored in ACNUC8465 zone)

EMBL: CU928166.PE399

CU928166.PE399       Location/Qualifiers
FT   CDS_pept        complement(782708..783535)
FT                   /locus_tag="KLTH0B09548g"
FT                   /old_locus_tag="KLTH-ORF14597"
FT                   /product="KLTH0B09548p"
FT                   /note="similar to uniprot|Q04868 Saccharomyces cerevisiae
FT                   YMR312W ELP6 Elongator protein part of the HAP subcomplex
FT                   of Elongator which is a six-subunit component of the RNA
FT                   polymerase II holoenzyme required for Elongator structural
FT                   integrity and histone acetyltransferase activity"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09548g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21764"
FT                   /db_xref="GOA:C5DDA3"
FT                   /db_xref="InterPro:IPR018627"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDA3"
FT                   /protein_id="CAR21764.1"
FT                   /translation="MSMAQKQDLVIFSDHSVLSRELFSKDLHHVLFVTHKLGTSPSWLI
FT                   NALVETQVLGFPATLNESHAAAVNRASNRKITDSKCATVASFIHNRGFFTSALKKLKVD
FT                   AECYNIIDYMTDFVLKNYGKPASKVLSSLLEELSNESATSELLILEQPELLVHLLNITS
FT                   DQLHLELINPLIKKFPLLVVVSYTEAYENVPSDSNEKLSSDMIEQIRFCNSCFFKSAAV
FT                   LGLKPLATGHASDVSGTLTITRGGASLSHLAVHVVENEYLFLTQKDTTKLFYR"
     atgtcgatgg ctcaaaaaca agacctagta atttttagcg accattctgt tttaagcaga        60
     gaacttttta gtaaggactt gcatcacgtc ttgttcgtga cccacaagct aggtacgtct       120
     ccttcctggt tgataaacgc tctggtggag acacaggttc ttggctttcc tgctacactc       180
     aatgagtcac atgcagctgc agtgaatcga gcttcaaata gaaagatcac tgattcgaaa       240
     tgcgcgacag tggcctcttt tattcacaat cgtggcttct tcacatcggc tctgaaaaag       300
     ctgaaggtcg acgctgaatg ctacaacatc attgactata tgacggactt cgtgctaaaa       360
     aactatggaa agcctgccag caaagtgctc agttcgttgc ttgaagaact gtctaacgag       420
     agcgcgacat ctgaattgct gatcctggag cagcctgagc tgcttgtgca tctgctcaac       480
     atcactagcg atcagctcca cctagaactg atcaatccct taataaaaaa atttcccctg       540
     ctggtggtcg tgagctacac tgaagcctat gagaacgttc cttccgattc caatgagaaa       600
     ctgtcttcag atatgataga gcagataaga ttttgcaata gttgtttctt caaaagcgct       660
     gctgtgctag ggctgaagcc tttggctacg ggccatgcaa gtgacgtaag tggtacattg       720
     actataacga ggggtggcgc gtcactgtct caccttgcag tacatgttgt tgaaaacgag       780
     tacctattcc ttacacaaaa ggataccaca aagttatttt atcgttaa                    828
//

If you have problems or comments...

PBIL Back to PBIL home page