(data stored in ACNUC8465 zone)

EMBL: CU928166.PE40

CU928166.PE40        Location/Qualifiers
FT   CDS_pept        complement(104224..106005)
FT                   /locus_tag="KLTH0B01188g"
FT                   /old_locus_tag="KLTH-ORF15847"
FT                   /product="KLTH0B01188p"
FT                   /note="highly similar to uniprot|P06169 Saccharomyces
FT                   cerevisiae YLR044C PDC1 Major of three pyruvate
FT                   decarboxylase isozymes key enzyme in alcoholic fermentation
FT                   decarboxylates pyruvate to acetaldehyde subject to glucose-
FT                   ethanol- and autoregulation involved in amino acid
FT                   catabolism and to YLR134W uniprot|P16467 Saccharomyces
FT                   cerevisiae YLR134W PDC5 Minor isoform of pyruvate
FT                   decarboxylase, key enzyme in alcoholic fermentation,
FT                   decarboxylates pyruvate to acetaldehyde, regulation is
FT                   glucose- and ethanol-dependent, repressed by thiamine,
FT                   involved in amino acid catabolism"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01188g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21405"
FT                   /db_xref="GOA:C5DC94"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012110"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC94"
FT                   /protein_id="CAR21405.1"
FT                   /translation="MSDLILYCDFYKTRNLNSNRVSQNKPEITMSEITLGRYVFERLKQ
FT                   VDVTTVFGLPGDFNLRLLDEIYEVEGMRWAGNCNELNASYAADAYARIKGMSCLITTFG
FT                   VGELSALNGIAGSYAEHVGVLHIVGVPSVSAQAKQLLLHHTLGNGDFTVFHRMSANISE
FT                   TTAMITDLATAPSEIDRCIRTTYIRQRPVYLGLPSNFVDQMVPASLLDTPIDLALKPND
FT                   QQAEEEVISTLLEMIKDAKNPVILADACASRHDVKAETKKLIDITQFPSFVTPMGKGSI
FT                   DEKHPRFGGVYVGTLSSPAVKEAVESADLVLSVGALLSDFNTGSFSYSYKTKNVVEFHS
FT                   DHIKIRNATFPGVQMKFVLQSLLNKVGAVVKDYKPVPVPELPAPNAAVDPSTPLKQQWL
FT                   WNQVGQFLQEGDIVLTETGTSAFGINQTHFPNNTYGISQVLWGSIGYATGACLGAVMAA
FT                   EELDKSKRVILFTGEGSLQLTAQEISTMVRWNLKPYLFVLNNKGYTIEKLIHGPTAEYN
FT                   EIQNWNHLDLLPTFGAKDYEAIRVSTTGEWNKLAEDKDFNKNSKIRLIELMLPVMDAPE
FT                   SLVKQAQLTAATNAKSA"
     atgtctgatt tgatccttta ttgtgatttt tataaaacca ggaacttaaa ctccaatcga        60
     gtatcccaaa acaaaccaga aataacaatg tctgaaatta ctctaggtcg ctacgtcttt       120
     gaaagattaa agcaggtcga tgttaccact gtcttcggtc tgccaggtga cttcaacctg       180
     cgtctgttgg acgagatcta cgaggtcgag ggtatgagat gggccggtaa ctgtaacgag       240
     ttgaacgctt cttacgctgc cgacgcttac gccagaatca agggtatgtc ctgtttgatc       300
     accaccttcg gtgtcggtga gttgtccgct ttgaacggta tcgccggttc ttacgctgag       360
     cacgtcggtg tcttgcacat tgtcggtgtc ccatccgtct ccgcccaggc caagcagcta       420
     ttgttgcacc acaccttggg taacggtgac ttcactgtct tccacagaat gtccgccaac       480
     atctctgaga ccactgctat gatcactgat ctagctaccg ccccatctga gatcgacaga       540
     tgtatcagaa ccacctacat tagacagaga cctgtttact tgggtttgcc atctaacttc       600
     gttgaccaga tggtcccagc ctctctattg gacaccccaa ttgacttggc cttgaagcca       660
     aacgaccagc aggctgagga ggaggtcatc tctactttgt tggagatgat caaggacgct       720
     aagaacccag tcatcttggc tgacgcttgc gcttccagac acgatgtcaa ggctgagacc       780
     aagaagttga ttgacatcac tcagttccca tctttcgtca ccccaatggg taagggttcc       840
     attgacgaga agcacccaag attcggtggt gtttacgtcg gtaccttgtc ttccccagct       900
     gtcaaggagg ccgttgagtc cgctgacttg gttttgtccg tcggtgcttt gttgtctgac       960
     ttcaacaccg gttctttctc ttactcttac aagaccaaga acgttgttga gttccactcc      1020
     gaccacatca agattagaaa cgccaccttc ccaggtgtcc agatgaagtt cgtcttgcag      1080
     agcttgttga acaaggtcgg cgccgtcgtc aaggactaca agccagtccc agtcccagag      1140
     ttgccagctc caaacgccgc tgtcgaccca tctactccat tgaagcagca atggttgtgg      1200
     aaccaggtcg gtcagttctt gcaggagggt gacatcgtct tgactgagac cggtacctcc      1260
     gctttcggta tcaaccagac ccacttccct aacaacacct acggtatctc ccaggtcttg      1320
     tggggttcca ttggttatgc caccggtgct tgtttgggtg ccgtcatggc cgccgaggag      1380
     ttggacaagt ctaagagagt tatcttgttc accggtgagg gttctttgca attgaccgcc      1440
     caggagatct ccaccatggt cagatggaac ttgaagccat acttgttcgt cttgaacaac      1500
     aagggttaca ccatcgagaa gttgattcac ggtccaaccg ctgagtacaa cgagatccag      1560
     aactggaacc acttggacct gttgccaact ttcggtgcta aggactacga ggccatcaga      1620
     gtttccacca ctggtgagtg gaacaagttg gctgaggaca aggacttcaa caagaactct      1680
     aagatcagat tgatcgagtt gatgttgcca gttatggacg ctccagagtc tttggtcaag      1740
     caggctcaat tgactgctgc caccaacgcc aagtccgctt aa                         1782
//

If you have problems or comments...

PBIL Back to PBIL home page