(data stored in ACNUC8465 zone)

EMBL: CU928166.PE401

CU928166.PE401       Location/Qualifiers
FT   CDS_pept        785306..786223
FT                   /locus_tag="KLTH0B09592g"
FT                   /old_locus_tag="KLTH-ORF14591"
FT                   /product="KLTH0B09592p"
FT                   /note="similar to uniprot|P53337 Saccharomyces cerevisiae
FT                   YGR284C ERV29 Protein localized to COPII-coated vesicles
FT                   involved in vesicle formation and incorporation of specific
FT                   secretory cargo"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09592g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21766"
FT                   /db_xref="GOA:C5DDA5"
FT                   /db_xref="InterPro:IPR002995"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDA5"
FT                   /protein_id="CAR21766.1"
FT                   /translation="MSFRGNSGFSGIPTTHQGYKQNPYTASAAGKSSSLKKTVMDELDK
FT                   LSNKVDDLTDHPVVQKLKPYTPAISRFFIVATFYEDSFRIISQWSDQVFFLWNYRHLPY
FT                   FFVVLFLLAVVLSMTVGATMLILRKRTIVATGVLCACIVLQGLVYGLYGGSFVLRNVSV
FT                   IGGLLIAFSDSIVQSKTTFGMLPELHNKDGKTKGFLLLMGRLLLVVLFVTFTFTKNWLT
FT                   VLLVIIGTICISVGFKTKLASILLGLILAFYNITVNNYWFYDSGKRDLLKYEYFQNLSI
FT                   IGGLLLVVSTGAGELSIDEKKKIY"
     atgtcattca gaggaaactc tggcttcagt ggtataccca caacccacca agggtacaaa        60
     caaaatccat atacggcatc ggcggcgggg aaatcgtcgt cgctgaagaa gacggtgatg       120
     gacgaactcg acaagctatc caataaggtg gatgatttga ctgatcatcc agtggtgcaa       180
     aaactgaaac cttacactcc tgcaatttct aggttcttta ttgtggccac gttttacgag       240
     gactctttta ggatcatatc tcagtggagc gaccaggttt ttttcttgtg gaactacaga       300
     cacctgccat acttcttcgt ggtattgttc ctgcttgccg tggtactttc catgacggtg       360
     ggtgccacaa tgcttatttt gcgtaagcgt acgattgtcg ccactggcgt gttgtgcgcc       420
     tgcatcgtgt tgcaaggcct cgtgtatgga ttatacggtg ggtcctttgt gctgcgtaac       480
     gttagtgtga ttggtggtct gctcattgca ttcagcgact cgatcgtgca aagcaaaacg       540
     acttttggta tgctacctga gctccacaac aaggacggca agacgaaggg ctttctcttg       600
     ctgatgggac gtctactgct ggtggtgctg ttcgtcacat tcacctttac caaaaactgg       660
     ctcactgtct tattggtgat catcggaacg atttgcattt ccgtgggttt caagaccaag       720
     ctggcatcca ttctcttggg gctgattttg gccttctaca acatcaccgt caacaactat       780
     tggttctacg atagtggtaa gagggatcta ttgaaatacg aatactttca gaacctcagc       840
     atcattggag gcctcctcct agtggtctcc acaggcgccg gcgagttatc aatcgacgag       900
     aaaaagaaga tatattga                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page