(data stored in SCRATCH zone)

EMBL: CU928166.PE402

CU928166.PE402       Location/Qualifiers
FT   CDS_pept        786773..787390
FT                   /locus_tag="KLTH0B09614g"
FT                   /old_locus_tag="KLTH-ORF14587"
FT                   /product="KLTH0B09614p"
FT                   /note="similar to uniprot|P41818 Saccharomyces cerevisiae
FT                   YMR311C GLC8 Regulatory subunit of protein phosphatase 1
FT                   (Glc7p) involved in glycogen metabolism and chromosome
FT                   segregation proposed to regulate Glc7p activity via
FT                   conformational alteration ortholog of the mammalian protein
FT                   phosphatase inhibitor 2"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09614g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21767"
FT                   /db_xref="GOA:C5DDA6"
FT                   /db_xref="InterPro:IPR007062"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDA6"
FT                   /protein_id="CAR21767.1"
FT                   /translation="MVGILKNPLPDRNGESEEPESISEFRKQVYKNTQLNAKLTSKAQN
FT                   NGKSTSKANAASPKRPVVPRDTLSLKHQHDTLSQAEEEKLKWNQQNLAENDIAKLEYKD
FT                   INIDEPKTPYQGAVDPTGEYYRDDDDELESLSLGEPVVEMPQSDSDNSSSSGPSDAEPS
FT                   AEESAEAKHRRFEELRKKHYNVKEALKAQRQNLDDEELEDED"
     atggttggta tattaaagaa tcctttgccc gatcgaaacg gtgagtcaga agagcccgaa        60
     tccatctccg agttcagaaa gcaagtttac aagaatactc agctaaatgc aaagcttact       120
     tctaaagccc aaaacaacgg gaaaagtaca agtaaggcga atgctgcgtc gccgaagagg       180
     cccgtggttc ctagggatac gctcagtttg aagcatcagc acgatacgct atcacaggcc       240
     gaagaggaaa agctaaaatg gaatcagcaa aacctggctg agaacgacat agccaagcta       300
     gaatacaagg atatcaacat tgacgagcct aaaactccat accagggtgc cgtcgaccct       360
     actggcgagt actaccgcga cgacgacgac gagcttgaga gcttgtcgct cggcgagcca       420
     gtcgtggaaa tgcctcaatc ggacagcgat aattctagta gcagtggacc aagtgatgcg       480
     gagccatccg cagaagagtc cgcagaagct aagcacaggc ggttcgagga gctgcgcaaa       540
     aagcactaca atgtcaagga agcgctgaaa gcacagcgcc agaacctgga cgacgaggaa       600
     ctcgaagatg aagattag                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page