(data stored in SCRATCH zone)

EMBL: CU928166.PE404

CU928166.PE404       Location/Qualifiers
FT   CDS_pept        789016..789939
FT                   /locus_tag="KLTH0B09658g"
FT                   /old_locus_tag="KLTH-ORF14583"
FT                   /product="KLTH0B09658p"
FT                   /note="highly similar to uniprot|P15703 Saccharomyces
FT                   cerevisiae YGR282C BGL2 Endo-beta-1 3-glucanase major
FT                   protein of the cell wall involved in cell wall maintenance"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09658g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21769"
FT                   /db_xref="GOA:C5DDA8"
FT                   /db_xref="InterPro:IPR000490"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDA8"
FT                   /protein_id="CAR21769.1"
FT                   /translation="MKFSTIASLAAVGVSYASAVGDLGFNLGVKNNDGTCKSTEDYAKD
FT                   LDILKGYTSTVKVYAASDCNTLQNLGPAAESAGFSVFVGVWPNDDAHFSAEKQALQSYL
FT                   PNIKTSTVKGILVGSEALYREDLTASELASKISEVKSLVADIKDSDGNSYSGTLVGTVD
FT                   SWNVLVDGGNADVIKASDMVMANAFSYWQGQTMDNASYSFFDDIMQAMQTIQTVKGTDI
FT                   PFWVGETGWPTDGTNFESSYPGTDNAAQFWQEGICAIRAWGVNVLVFEAFDEDWKPNTS
FT                   GTSDVEKHWGVWTSGDELKYSLDCKF"
     atgaagtttt ctacaattgc atcgctagct gctgttggtg tgtcgtatgc gtccgccgtt        60
     ggtgaccttg ggtttaacct aggtgtcaag aacaacgacg gcacatgcaa gagcaccgag       120
     gactacgcca aagacctaga tattttgaag ggctacacga gtactgtcaa ggtctacgct       180
     gcttctgact gtaacaccct acagaacttg ggacctgctg ccgagtccgc tggattcagt       240
     gtcttcgtgg gcgtgtggcc taacgacgac gctcacttct ccgcggagaa gcaggccttg       300
     cagtcttact tgcctaacat caagacctcc accgtcaagg gtatccttgt tggttctgag       360
     gccctttacc gtgaagacct gaccgcgtcg gagcttgcca gcaagattag cgaggtcaag       420
     tcgctggtcg ccgacatcaa ggactccgat ggtaactcgt actctggcac tctcgtcggt       480
     acagtcgact cctggaacgt gctggtcgac ggtggcaacg ccgacgtcat caaggcctct       540
     gacatggtca tggccaacgc gttctcgtac tggcagggcc agaccatgga caacgcttcc       600
     tactctttct tcgacgatat catgcaagct atgcaaacca tccagactgt caagggtact       660
     gacattccat tctgggttgg tgagaccggc tggccaactg acggtaccaa cttcgaatcc       720
     tcttaccctg gcaccgataa cgccgctcaa ttctggcaag agggtatttg tgccatcaga       780
     gcctggggcg tcaacgttct ggtcttcgag gctttcgacg aagactggaa gccaaacacc       840
     tctggtactt ctgacgttga gaagcactgg ggtgtgtgga cttccggcga tgagctgaag       900
     tactcgttgg actgtaagtt ttga                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page