(data stored in SCRATCH zone)

EMBL: CU928166.PE405

CU928166.PE405       Location/Qualifiers
FT   CDS_pept        790481..792934
FT                   /locus_tag="KLTH0B09680g"
FT                   /old_locus_tag="KLTH-ORF14578"
FT                   /product="KLTH0B09680p"
FT                   /note="similar to uniprot|P32497 Saccharomyces cerevisiae
FT                   YMR309C NIP1 Subunit of the eukaryotic translation
FT                   initiation factor 3 (eIF3) involved in the assembly of
FT                   preinitiation complex and start codon selection"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09680g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21770"
FT                   /db_xref="GOA:C5DDA9"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR008905"
FT                   /db_xref="InterPro:IPR027516"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDA9"
FT                   /protein_id="CAR21770.1"
FT                   /translation="MSRFFANSYDYESGSSSSEEDLLSTSEEELMSSSSSEEEQANDSF
FT                   FDESESESDVDSDGSGDRPYGPDWFKKPEFRKGGSTGANKFLKNADYSNSEDSDDEGRK
FT                   VVKSAKDKLLDEMRGVYDKIEDAEMTQDWITILAELDNMTRLSTRAQQQNYGVPNIFVK
FT                   VLAQVEDAVAATSLQDINNKAVARAYNTTKQRVRKVARDYEQALSSFRENPEAHADDEA
FT                   VQDNNSVSTFALAGKKTADLSSMATASSESDFFTALRIVIDSRGKKGTDFQAQIKTLEE
FT                   LLDIAKSPYETILAYLNLIPIRFDSSATLSYQPIDQWKASQQDIAKLFDTLEDSIDAYH
FT                   VSELAPHNDFIEEEPQPNEQGIKQVLGSVYSFVERLDEEFNKSLLNTDPHSSDFLDRLK
FT                   DEQGVYNLILRSQLYLEATSSDSELERRLARVLTRRFDHIYFKSVKLVEVSESKAWKSL
FT                   REGAKSKVTPLDGEVDESYTFGLIDTLHKMLSTQKDGAQRRRAGLYQIYFYALNNQFEK
FT                   AKHMLLSSHIQSSINNADAPLQILFNRTVVQLGLAAFKLCLIDDCHQILNEVSTSTHLR
FT                   DILGQQSLQRVAANNATNPGGASNEQLCLPFHQHINLDLIDVVFMTCSLLIEVPHMAAF
FT                   FSGIKVKRIPYSQKSIRRALEHYDKSSFQGPPETLRDHVLYAAKSMQRGDWDKSVEYLK
FT                   KVPTWSLLPNTAEVLTNLAHRVQVEALRTYIFTYKRFYSKLSLLKLSQLFGLSQETVVE
FT                   VVSAIISQYDIKGRLDEESKFLVFEKGYEITKLEEVAVKLAKETKYVSERLNEKKYVGS
FT                   SRKQE"
     atgtctcggt tctttgcgaa tagttatgat tacgagagcg gatcttcgtc gtccgaagaa        60
     gacctacttt ccacgtcgga ggaggagctc atgagctcat cttcgtccga ggaagaacaa       120
     gcaaatgatt ctttctttga cgagtccgag tccgaatcag acgtcgactc cgacggttct       180
     ggcgacaggc cgtatggtcc tgattggttt aagaagcctg agttcagaaa gggcggctct       240
     actggtgcca acaagttttt gaagaacgct gattactcta attccgagga ttctgatgac       300
     gagggcagga aggtggtcaa gtccgccaag gacaagcttt tggacgaaat gcgcggcgtt       360
     tacgacaaga ttgaggacgc agagatgacc caagactgga ttacaattct cgccgaactt       420
     gacaacatga cacgtttgag cactagagcc cagcagcaaa actacggtgt ccccaacatc       480
     ttcgtgaagg tgctagcgca agtcgaggat gccgtcgcgg caacctcgct ccaagacatc       540
     aacaacaagg cagtggcgcg tgcatacaac accacaaagc agagagttag aaaggttgct       600
     cgtgactacg agcaggctct gtctagcttc cgcgagaacc cagaagctca tgctgatgac       660
     gaagccgttc aagacaataa ctccgtgtca acttttgccc tggctggcaa gaagaccgct       720
     gacttgtctt ctatggcgac cgcatcttct gagtccgact tcttcacagc gctccgcatt       780
     gtcatcgact ccagaggtaa gaagggtact gacttccagg cacagatcaa gaccttggag       840
     gaattgctgg atattgccaa gagcccatac gaaactattc ttgcatactt gaacctcatc       900
     cccatcagat tcgactcttc cgcaacgctt tcataccagc ctatagacca atggaaagcc       960
     tctcagcaag atatcgccaa gttgttcgat accttggaag acagcattga cgcttatcac      1020
     gtctccgagt tggcgcctca caacgacttc atcgaggaag agcctcagcc aaacgagcag      1080
     ggcatcaagc aggtgttggg ttccgtttac tcttttgttg agagacttga tgaggagttc      1140
     aacaagtctt tgctcaacac tgaccctcac tccagcgact tcttggaccg cttgaaggac      1200
     gagcaaggcg tttacaattt gattttgaga tcgcagttgt acttggaggc gaccagctcc      1260
     gacagcgagt tggagagacg tttggcccgc gtgctgacta gaaggtttga ccacatctac      1320
     ttcaaatctg ttaagcttgt ggaggtttcg gagtccaagg cgtggaagag cttgcgtgaa      1380
     ggcgccaagt cgaaggtcac gcctttggac ggcgaggtgg acgaaagtta cacctttggt      1440
     ctgatcgaca ctttgcataa gatgctatca actcagaagg acggtgctca gcgcagaagg      1500
     gccggtttgt accaaattta cttctacgcc ctgaacaacc agttcgagaa ggccaagcac      1560
     atgttgcttt cttcgcatat ccaatcatct atcaacaacg cggacgcccc gttgcagatt      1620
     ctgttcaaca gaactgtcgt acaactgggt ctcgcggcct tcaagctgtg cttgatcgac      1680
     gactgtcatc agattctgaa cgaggtctcc accagcacac atttgagaga catcttgggt      1740
     caacaaagct tgcagagagt tgccgcgaac aacgcgacca accccggcgg ggcgtccaac      1800
     gagcaactgt gcctgccatt ccaccaacac ataaacctgg acttgatcga cgttgtgttc      1860
     atgacttgtt cgctgctgat cgaggttcct cacatggcgg cgttcttctc gggcatcaag      1920
     gtcaagagaa tcccctactc ccagaagtcg attcgtcgcg cgctcgagca ctacgacaag      1980
     tccagtttcc agggccctcc agaaaccctg agagaccacg tgctgtacgc tgctaagtcc      2040
     atgcagagag gagactggga caagtccgtc gagtacctga aaaaggtccc tacctggtcg      2100
     ctgctgccaa ataccgccga ggtgctgacc aacctggctc acagagtgca ggtggaggcc      2160
     ttgagaacgt acattttcac atacaagagg ttctactcca agctttcgtt gttgaagctg      2220
     tcgcagctgt tcgggctgtc gcaggagacc gtggtggagg tggtgagcgc gatcatctcg      2280
     cagtacgaca tcaagggcag actggacgag gagtccaagt tcctggtgtt cgagaagggt      2340
     tacgagatca cgaagctgga ggaggtggcc gtgaagctgg ccaaggagac caagtacgtg      2400
     agcgagcgtc tcaacgagaa gaagtacgtg gggtcctcgc gcaagcagga gtag            2454
//

If you have problems or comments...

PBIL Back to PBIL home page