(data stored in SCRATCH zone)

EMBL: CU928166.PE408

CU928166.PE408       Location/Qualifiers
FT   CDS_pept        805761..809039
FT                   /locus_tag="KLTH0B09768g"
FT                   /old_locus_tag="KLTH-ORF14534"
FT                   /product="KLTH0B09768p"
FT                   /note="similar to uniprot|P32337 Saccharomyces cerevisiae
FT                   YMR308C PSE1 Karyopherin/importin that interacts with the
FT                   nuclear pore complex acts as the nuclear import receptor
FT                   for specific proteins including Pdr1p Yap1p Ste12p and
FT                   Aft1p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09768g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21773"
FT                   /db_xref="GOA:C5DDB2"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR034085"
FT                   /db_xref="InterPro:IPR040122"
FT                   /db_xref="InterPro:IPR040928"
FT                   /db_xref="InterPro:IPR041389"
FT                   /db_xref="InterPro:IPR041653"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDB2"
FT                   /protein_id="CAR21773.1"
FT                   /translation="MSALPDEVNTTLVNVLHGFSSPDNGIRAAAEETLNKDWITPDNIE
FT                   VLLIFLSEQAAYSPEPTLAALSAVLFRKLALRAPPSSKTVIIAKNITHISESALNQIRE
FT                   TLLKGFVTERQGGIRHKLSDAIAECAQEDLPEWPALLQGLFEAIKNPDANFRESSFRIF
FT                   TSVPHLINAVDINSVLPIFEAGFTDSDDNVKVAAVTAFVGYFKQLPKQHWAKLGILLPS
FT                   LLNSLPNFLDGGKDDALASVFESLIELVELAPKLFKNMFDQMIQFTDIVIKNKDLETSA
FT                   RTTALELLTAFSESAPQMCKSTPSYAQSLIMNTLLMMTEVSIDDDQASDWHDSDDTEED
FT                   DEEVTYDHARQALDRVSLKLGGKYLAPPLFQYLQQMVSSSEWRERFGALMALSSAAEGC
FT                   RDVLIGEIPKILDMIVPLINDPHPRVQYGCCNALGQISTDFAPLIQRTSHERILPPLIS
FT                   KLTPQSVDRVQTHAAAALVNFSEHATQTILEPYLDDLLTNLLTLLQSTKFYVQEQALTT
FT                   IAFIAEAAEKKFIKYYDTLMPLLINVLKTDTGNANRLLKGKCIECSTLIALAVGKEKFL
FT                   TQSQELIELFIAYQNQGIDDDDPMKSYLEHGWSRICRILREDFVPLLPVVIPPLLETAK
FT                   ATQDVSLIEEEDAANFQQYSDWDVVQIQGKHIAIHTSILDDKVSAMELLQVYTTILKNF
FT                   FAVYVPEIMKEIAVPSIDFYLHDGVRATGAGLIPVLLSALVSATGVQNSDVLQLWHLAS
FT                   TKLLNGIISEPMPEITQIYHTALVDGLAIMGENSLSDEQLLQYTKGLSANLSDIYERVK
FT                   QRRNQEDEYNEDVDDDFEDYTDEDLLDDINKSLAAVFKSTGGRYLNQFQTLWPLVVTYL
FT                   RDGEVILTLFALCAIGDMIETAGPATEVYKDSFINEVKEYLVSPEASIRQAAAYVIGVC
FT                   AQHSRDVYAQECSQSLDTLVRVISIPDAKSEENVTSTENASAAIAKILHSYGPNVPNFD
FT                   NYVSNWLKTFPIVQDEEAAAFNYRFLAHLIDSNSPAVHNSAAIPHILDSVVQALHHKSL
FT                   VGKNASAVVESTKKLLGTLPQSEAMNLFQRYPSDVVQEVQHWFA"
     atgtcagcgc ttccagatga ggtgaacacc accttggtga acgtactgca cgggttctct        60
     tcacctgata acggaatccg tgcagcagca gaggaaactc tcaataaaga ctggattact       120
     ccagataaca ttgaagtgct tttgatcttc ctctcggagc aggcggcata ctctccggag       180
     ccaactcttg cagcgttatc agccgttctt ttccgaaaac tagctttaag agcgcctcca       240
     tcctcaaaga ctgtcattat tgccaagaac atcacgcaca tcagcgagag cgcacttaac       300
     cagatacgtg aaacgctact gaagggattt gtcaccgaaa gacaaggagg aatcagacac       360
     aagctgtctg atgccattgc tgaatgtgct caggaagact tgcctgaatg gcctgcctta       420
     ttgcaaggct tgttcgaggc catcaaaaat ccagatgcaa acttccgcga atccagcttt       480
     agaattttta catctgtgcc acatcttatc aatgcagttg atatcaacag tgtgcttcca       540
     atttttgaag ctggttttac tgattccgat gacaatgtta aggtcgctgc ggtgaccgca       600
     ttcgtaggtt actttaagca gctaccaaaa cagcactggg cgaaacttgg cattctgttg       660
     cctagcttat taaacagtct tccaaacttt ttagacggtg gtaaagatga tgctttggca       720
     tcggttttcg agtccctcat agagctggtt gagctagcac ctaagttgtt caaaaatatg       780
     tttgaccaaa tgatacagtt cactgatatt gttataaaga acaaggactt ggagacctcg       840
     gctagaacca cagcactgga attgcttacg gccttcagcg aaagtgctcc gcagatgtgc       900
     aaatccactc ctagctatgc ccagtcattg ataatgaaca cgctgctaat gatgactgaa       960
     gtttcaatcg acgacgacca agcctctgac tggcatgact cagacgatac agaggaggac      1020
     gacgaagaag ttacctacga ccatgcacgt caagctttgg atcgtgtttc cttaaagctt      1080
     gggggcaaat accttgctcc tcctttgttt caatacttgc aacaaatggt ttcgtcttct      1140
     gaatggagag aaaggtttgg tgctttaatg gctctatcct cagccgcgga aggctgcaga      1200
     gatgtgctta ttggcgagat tcctaaaatc ttggacatga ttgtgcctct catcaacgac      1260
     ccccacccta gagttcaata tggttgctgt aacgcgctgg gccagatatc aactgatttt      1320
     gctccactga tacagagaac gtctcatgaa aggattttgc ctcctttgat ttctaagtta      1380
     actcctcaat cggtcgacag agttcaaact cacgcagcag cagctctggt caacttttcg      1440
     gagcacgcca cccaaaccat tttggagcct tatctggatg atttattaac taaccttcta      1500
     acgctgctac aaagtaccaa attctatgtt caagagcaag cgctcactac tatagctttt      1560
     attgcggaag cagctgagaa aaagttcatc aaatattatg ataccttgat gccgcttttg      1620
     attaacgtgc tgaaaacaga caccggtaat gctaacaggc ttttgaaggg aaagtgcatt      1680
     gaatgttcta ctctgatagc tttggccgtg ggcaaggaaa aattccttac acaatctcag      1740
     gagttgatag aactctttat tgcatatcaa aatcaaggca tagacgatga cgatcccatg      1800
     aagtcgtatc tcgagcatgg ctggagtaga atttgcagaa tattgagaga agacttcgtg      1860
     cccttattgc ctgtggtgat acccccatta cttgaaactg ctaaagctac gcaagatgtc      1920
     agcctcattg aagaggaaga tgctgcaaac ttccagcagt attctgattg ggacgttgtt      1980
     cagattcaag gcaagcatat cgctatccat acctctattc tggatgacaa agtctcagcc      2040
     atggagctgc tccaggtcta cactactatc ctgaaaaact tcttcgccgt ctacgtgcca      2100
     gagatcatga aagagattgc ggtaccatcg attgacttct acttacacga tggtgtgaga      2160
     gcaactggcg caggattgat ccctgtctta ctatctgctc ttgtctcggc cactggtgtg      2220
     cagaacagtg atgttcttca actttggcat ttggcttcca ccaagctgtt gaatggaata      2280
     atctcagaac caatgcccga gattactcaa atttaccaca cggctttagt cgatggtttg      2340
     gccattatgg gtgaaaacag cttgagcgac gagcagttgc tgcagtatac taagggcttg      2400
     tcggccaatt tatcagatat ttacgagcgt gtcaagcaac gccgcaatca agaagacgaa      2460
     tataacgagg atgttgatga cgattttgaa gattacacag atgaggattt actcgatgac      2520
     atcaacaaat cgttggcggc tgttttcaaa tcaacgggtg gaagatactt aaaccagttc      2580
     caaactttgt ggccacttgt cgtcacctat ctcagagacg gcgaggtcat cttgacctta      2640
     tttgcactat gtgctattgg ggacatgatt gagacagctg gccctgctac agaagtgtac      2700
     aaggacagtt tcatcaacga agtgaaggaa tatcttgtct cacccgaagc ttctattcgt      2760
     caagcagctg cctatgtgat cggtgtgtgc gcacagcaca gtcgtgacgt ttatgcacag      2820
     gagtgttcgc agtcactgga taccttagtt cgtgtgattt ctattcctga tgccaaatct      2880
     gaggagaatg ttacctccac tgaaaatgca agtgctgcta ttgccaagat tttgcacagt      2940
     tatggtccta atgttccaaa cttcgacaac tacgtttcca actggctcaa aactttcccc      3000
     attgttcagg atgaagaagc agcagctttt aattatagat tcttggctca tttgattgat      3060
     tccaattccc cagcggttca taactctgct gccattcctc atattttaga ctccgttgta      3120
     caagctttgc atcacaaatc attggtcggg aaaaatgcaa gtgcagtcgt tgagtctacc      3180
     aaaaaactcc tgggcacact gccccaaagc gaggctatga acctttttca gcggtatcct      3240
     tctgacgtcg tccaggaagt tcagcactgg tttgcctga                             3279
//

If you have problems or comments...

PBIL Back to PBIL home page