(data stored in SCRATCH zone)

EMBL: CU928166.PE409

CU928166.PE409       Location/Qualifiers
FT   CDS_pept        809351..810328
FT                   /locus_tag="KLTH0B09790g"
FT                   /old_locus_tag="KLTH-ORF14531"
FT                   /product="KLTH0B09790p"
FT                   /note="some similarities with uniprot|P53335 Saccharomyces
FT                   cerevisiae YGR280C PXR1 Protein with a role in maturation
FT                   of rRNAs and small nucleolar RNAs required for cell
FT                   viability"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09790g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21774"
FT                   /db_xref="GOA:C5DDB3"
FT                   /db_xref="InterPro:IPR000467"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDB3"
FT                   /protein_id="CAR21774.1"
FT                   /translation="MGLAATKNKQKLGLDPRNTAWSNDTSRFGHKHLEKMGWRPGSGLG
FT                   MMPNATTTHVKVSIKDDNLGLGAKLRKKDKADEFDSGECAGLDAFQRLLGRLNGKEDSV
FT                   SNELDIQKKQNIINGKWGIHFVKGDVLASTWDAKTKTLKLYSNESTKRKLDSEDEEYPS
FT                   SRESKRSKKSKESRKSDKKKDVSEEDKETVKKGDKSRKDKDKKLKKDGDTKDKKEKRVK
FT                   KEKKDKKDKKDKHKMKKTEDKKQKHKKSEKDRDEKHKNKKDKKREYKSSKSNKVSRESM
FT                   LKPRDPQENAIASRLSVRSKWIKQKRAAVMDAQALNEIFMVTTQ"
     atgggtctag cggcaacaaa gaataaacaa aagctggggc tcgaccctag aaacacagcg        60
     tggagtaacg atacttcacg cttcggtcac aagcatctcg aaaagatggg ctggaggccc       120
     ggttccggtt taggaatgat gccaaatgca accacaacac acgtcaaagt gtctatcaaa       180
     gacgacaacc tcgggcttgg agcgaaatta cgcaagaaag ataaagctga tgaattcgat       240
     agcggtgaat gcgcaggttt ggatgccttc cagcgccttt tggggagact caatgggaag       300
     gaagattctg tgtcaaacga gctagatatc caaaagaagc aaaacataat caacggaaag       360
     tgggggattc attttgtcaa gggtgacgtc ttagcaagta catgggacgc caaaactaag       420
     acgttaaaat tatacagtaa cgaaagcacc aagagaaagc ttgatagcga agatgaagaa       480
     tatccgagtt ctagagagag caaaaggagc aaaaagagta aagagagtcg aaaaagcgac       540
     aaaaagaagg acgtgagcga agaggacaag gaaactgtca aaaaaggcga taagagcagg       600
     aaggacaaag acaagaaact taagaaggac ggggatacta aagacaagaa agagaagaga       660
     gtcaagaagg agaagaaaga taagaaggac aagaaggaca agcataagat gaaaaaaacc       720
     gaagacaaaa aacagaagca caagaagagc gagaaggacc gcgacgagaa acacaaaaat       780
     aaaaaagaca aaaagcgaga gtacaagagc agcaaatcga acaaggttag tcgtgagtcc       840
     atgttgaagc caagagatcc tcaagaaaat gctatcgcgt caaggctctc agttcgttca       900
     aaatggatca agcaaaaacg tgcagcagtt atggatgctc aggctttaaa cgaaattttt       960
     atggtgacca cccaataa                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page