(data stored in ACNUC8465 zone)

EMBL: CU928166.PE417

CU928166.PE417       Location/Qualifiers
FT   CDS_pept        831234..833657
FT                   /locus_tag="KLTH0B09966g"
FT                   /old_locus_tag="KLTH-ORF14499"
FT                   /product="KLTH0B09966p"
FT                   /note="similar to uniprot|P32843 Saccharomyces cerevisiae
FT                   YMR302C PRP12 Integral inner mitochondrial membrane protein
FT                   with similarity to exonucleases"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B09966g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21782"
FT                   /db_xref="GOA:C5DDC1"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR018850"
FT                   /db_xref="InterPro:IPR034260"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR039627"
FT                   /db_xref="UniProtKB/TrEMBL:C5DDC1"
FT                   /protein_id="CAR21782.1"
FT                   /translation="MLALLSRSLRPVRYGRVKPNILLPLKRQVSTEIQEKDEQAGESTT
FT                   ATDTGVIHKTEEETLIYFDNVYPRATSLWSPTQWYNILLTNQSRDAVRSKIMEFASPPR
FT                   NPIHGLELRSTIPVKRDGGVFATFLVPRDYSKAQVNSIIQQNTAKESSKSILSFVTRAA
FT                   AFPVKGSPWIEDLRRLPSTVIKIKFEGQPLTEEEIYSLFRRYGTILDIYPSKKGDTVAT
FT                   LRYRSYRGAICAKNCVSGMEVHNSTIHVQYQRLADEHMIRDFFVNHQRIAIPLMIALLS
FT                   IVAVLVFDPIREFSVRQKITHRFAFSRENYLIKELFKLTSFTVSSFKSLIGSENVETNK
FT                   KQLWEERIEKVSDLKMWLEENNNTFVIVRGPRGSGKHDLVIQHTLHDRPNVLYLDCDKL
FT                   IKSRTDSKFLMNAAAEIGYFPIFPWINSFTNVVDLAVQGLTGQKTGLSESKETQFRNML
FT                   TTALMAIRQVALKGYHPIVGRGDDAITMKEEDYLQQHPEKKPVIVIDRFNDKAEMNGFA
FT                   YKELSDWAAMLVQMNIAHVIFLTETVSPNQLLADSLPNQVFKTLILSDASKESARSYVL
FT                   ASLDHTEPLDDDQEKSKPIILSDDIKRELDESLEPLGGRMLDLQAFVRRVKSGENPKEA
FT                   LDKMVEQALEQITQIFLAENVDQVKSAQAWELIEMLSKEPVVEFKNVVFRPLFKSAPEA
FT                   GLLELEKNGLITVSRDRGVLKDIRPAKPLYRAAFGYLLNDSELFTVLETGYLLRIINFE
FT                   TKRIQKWEEELKSLGKVSEHRMFKSRLLYLAAKIDASSDSINKCEDKIKALARS"
     atgctggcgt tacttagcag atccctcaga cccgtgagat acgggcgagt gaaacctaat        60
     atccttctgc ccttaaagag acaagtttcc accgagattc aggaaaagga tgaacaagct       120
     ggcgaatcaa caaccgctac ggacactggt gttatacata aaaccgaaga agaaactttg       180
     atctatttcg ataatgtata cccaagagcc acatcccttt ggagtccaac tcagtggtac       240
     aatattctcc ttacgaatca atcaagggat gcagtgcgtt caaagatcat ggaattcgca       300
     agcccgccaa gaaacccgat tcatggcctc gagcttaggt ccacgatacc tgttaaacgg       360
     gacggtggtg tatttgcgac gttcctggtc cccagagact actctaaagc tcaagtgaac       420
     tcgataatcc aacaaaacac tgccaaagaa tcatccaaat ctatcctctc gtttgtaact       480
     agagcagctg cttttccggt gaaggggtct ccttggatcg aagacttaag aagattacca       540
     agcacagtta tcaagattaa atttgaaggt cagcctctta ccgaggagga gatctactct       600
     cttttcaggc gctacggtac aatacttgat atatatcctt caaaaaaggg ggacacagtt       660
     gcaacactta ggtacagatc atatcgcggt gctatttgtg ctaagaattg cgtttctgga       720
     atggaggtgc acaacagcac tattcatgtg caatatcaaa gacttgctga cgaacacatg       780
     atacgtgatt tttttgttaa ccaccaaagg attgctatac ctttgatgat tgccttgcta       840
     tctattgttg ctgtattggt ttttgaccca attcgtgagt tctctgtgcg tcagaaaatc       900
     actcacaggt tcgccttttc cagagaaaac taccttatca aggaactttt taaactaact       960
     tccttcacgg tatcatcttt caagagtcta ataggatctg aaaatgtcga gacaaacaaa      1020
     aagcaactat gggaagaacg cattgaaaaa gtgagcgatt tgaaaatgtg gctggaagaa      1080
     aacaacaaca cctttgtcat tgttagaggt cccagaggct caggaaagca cgaccttgtc      1140
     atccagcaca ctttgcatga cagacctaat gttctttatc tggactgcga caagttgatt      1200
     aagtcacgaa cagattccaa atttctcatg aatgctgcag ctgaaatagg ctatttccct      1260
     atcttcccct ggatcaattc attcacgaac gtcgtggatt tggcggtcca aggactaacc      1320
     ggccaaaaaa ctggtttgtc ggagagtaaa gaaactcagt ttaggaatat gctaacaaca      1380
     gcattaatgg caataaggca agttgctttg aaaggatatc accctatcgt tggtaggggc      1440
     gatgatgcca tcactatgaa agaagaagat tacctacagc agcaccctga aaagaagcct      1500
     gtaattgtca tcgatcgctt taatgacaaa gctgaaatga atggtttcgc ttacaaagag      1560
     ttatcggatt gggctgccat gttagttcag atgaatattg cgcatgtcat tttcctaaca      1620
     gagacagttt ctcccaatca attgcttgcc gactctcttc ctaaccaggt gttcaaaact      1680
     ctcatcttat cagatgcatc taaagaatct gcccgttcct atgttctcgc atcccttgac      1740
     cacacagagc ccctagacga tgatcaggag aaaagtaaac cgattatctt atctgatgat      1800
     attaaaagag agcttgatga gtctctcgaa ccgcttggag gtaggatgct ggatcttcaa      1860
     gcgtttgtga gaagggtcaa atcgggcgaa aaccccaagg aagctctcga taaaatggtg      1920
     gagcaggcac ttgagcagat aacgcagata tttttggctg aaaatgttga tcaggttaag      1980
     agcgcacaag cgtgggaact tatcgaaatg ttgagtaaag agcctgttgt tgaatttaag      2040
     aatgttgttt tcaggcctct tttcaagtcg gcgcccgaag cagggctact ggagctggaa      2100
     aaaaacggct tgattactgt ttcaagagat agaggggttt tgaaggatat tcgcccggca      2160
     aagcctcttt acagagctgc gtttgggtat ttgcttaacg atagtgaact ttttacagtg      2220
     cttgagacag gttatttgtt gcggatcatc aatttcgaaa ccaaaagaat acaaaagtgg      2280
     gaagaagaac tgaaatcact cggaaaagtg agtgaacaca ggatgttcaa aagtcgactt      2340
     ttgtacctag ctgccaaaat tgacgccagt agtgatagca tcaacaaatg cgaagacaag      2400
     atcaaggcgc tagccaggtc ttaa                                             2424
//

If you have problems or comments...

PBIL Back to PBIL home page