(data stored in SCRATCH zone)

EMBL: CU928166.PE42

CU928166.PE42        Location/Qualifiers
FT   CDS_pept        complement(108265..110865)
FT                   /locus_tag="KLTH0B01232g"
FT                   /old_locus_tag="KLTH-ORF15843"
FT                   /product="KLTH0B01232p"
FT                   /note="similar to uniprot|P46675 Saccharomyces cerevisiae
FT                   YLR045C STU2 Microtubule-associated protein (MAP) of the
FT                   XMAP215/Dis1 family regulates microtubule dynamics during
FT                   spindle orientation and metaphase chromosome alignment
FT                   interacts with spindle pole body component Spc72p"
FT                   /db_xref="EnsemblGenomes-Gn:KLTH0B01232g"
FT                   /db_xref="EnsemblGenomes-Tr:CAR21407"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="InterPro:IPR024395"
FT                   /db_xref="InterPro:IPR034085"
FT                   /db_xref="UniProtKB/TrEMBL:C5DC96"
FT                   /protein_id="CAR21407.1"
FT                   /translation="MADSEDGDFTSLPLSERLDHKLWKARLHGYQELQALFQKASVTSV
FT                   PRELAQYWANPDLFAGYIVDSNVVAQEQAITALQNMLEYLCEFRDTPRSDEMRGRWLPL
FT                   LAEKGLSSSRNSTKAKAQECVLILVSLDRSVEHSIELLEPSLTNKLPRLVANCVECISN
FT                   IVESFGLAQVSNMSGFLPVLLEPLPKLSSHADRNVRSQTMNLILQLYKWLGRDLLQELL
FT                   LEKLKPIQQRDLDKTFGKYDGEIPPTSQPRPFQWQKGLEVQNLEGSKDKDGDTLMGESF
FT                   PDVKAHANPGLPQLDPFELLPVSPVLEKFPLDFMERITSSKWKDRVEVLEEILNQVLIP
FT                   TKKFEAKGQDYSDFLRAVAHVIEKDANVQAVTLAAQCVQQLCQKLKANFTRSYGSIVLR
FT                   SLLERSKEKKASVNEAICEALNNIADCCGVDACLEDNLSFINHKTPQVRTESTRFLTRL
FT                   LKKWTPEGRHFGDELLIKLVPDISQMLLKIVGDTQPTVRDAGFECLATLMKLVGEREVS
FT                   DVLDKLDNLKKKKVYEHYEKVEVAGGATKGAVTSAPARREKPSMPYTPNASRRQAPRTT
FT                   PTPDLSAQATSGSTLPLRKPLSTIPSKRGPSSPLKTGTRVETYQDGASSMKSRLTARSL
FT                   TTDSAPASKPQAAPHAGFEELQRQKQKWLKERQEFLATITDFQNKASHLSSENSSLRQQ
FT                   LDTVQSSLHESNIELRSKEMQITRLQDRISNLEQELEAKSTLPSSNYGVRSASSFEPPS
FT                   APLSLAPPGTPPTKRVFSSSSNGRASPSFDANSDRIADSRLPSVGSRLRSPSECSDDLP
FT                   HRVNSLQLRSAERAATTGNSFLNDESWKRAAEVTSQLKARIERMRAKTRGMGNS"
     atggcagact ccgaagacgg cgattttacc tctctgccgc tctccgaaag attggatcac        60
     aagctatgga aggcgcgcct gcacgggtac caggagctgc aggcgctgtt ccaaaaagct       120
     tctgtgacat ctgtcccgcg ggaactcgcg cagtattggg ccaaccctga cttgttcgcc       180
     ggctatattg tggactctaa tgttgtagca caggagcaag cgataacagc actgcaaaat       240
     atgcttgagt atctatgcga gttccgggat acgccgcgct cagacgaaat gcgtgggcgc       300
     tggctgccgt tactggccga gaaaggcctc agttcatcgc gtaactcgac aaaggccaaa       360
     gcccaggaat gcgtccttat cttagtatcg ctcgatcggt ccgtggaaca ctctatcgag       420
     cttttggagc cttcactcac caataagctc cccaggcttg tcgctaactg tgtcgaatgc       480
     atatctaata ttgtggagag ttttggcctg gcacaagtta gcaacatgtc cgggtttcta       540
     cctgttctgc ttgaacccct gccgaaactt tctagtcatg ccgaccgaaa cgttaggtct       600
     caaaccatga atctcatcct gcagctttac aagtggctag gtcgggacct actccaggaa       660
     ctgctgttag aaaagttgaa gcctatccag cagcgtgacc tcgacaagac gtttggcaaa       720
     tacgacggcg agatccctcc aacctcccaa ccgcgtccat ttcagtggca gaaggggctc       780
     gaagttcaaa atttagaagg tagcaaagac aaggatggtg acaccttgat gggagagtct       840
     tttcctgatg tcaaagctca cgcaaatcct ggacttcctc agcttgaccc tttcgagctc       900
     ctgccagttt cgccggttct cgaaaaattt ccgctcgatt tcatggaaag aataacatca       960
     tccaagtgga aggatcgtgt tgaagttctg gaagaaatac tcaaccaagt tctgattcca      1020
     accaagaaat ttgaggccaa gggccaggac tacagtgatt ttttgagggc tgtcgctcat      1080
     gtaatagaga aagatgcaaa tgttcaagcg gttacactgg cagcacaatg cgtccagcaa      1140
     ttatgccaga agctgaaagc aaacttcacc aggagttacg gctccattgt gctgagatca      1200
     ctgctcgagc ggtccaaaga gaagaaggct tcggtgaatg aagcgatttg cgaagcactc      1260
     aacaatattg ccgactgctg tggtgtagat gcttgcctcg aagacaattt gagctttatt      1320
     aaccacaaaa ctccccaggt tcgaacagaa agtactaggt ttctgacgcg ccttctgaaa      1380
     aaatggacgc ctgaaggtcg ccactttggc gatgagctgc tcatcaaatt agtacctgat      1440
     atttcacaaa tgctacttaa aatcgttgga gatactcagc caacagtacg tgacgccggg      1500
     ttcgagtgct tggctacctt aatgaagctc gttggagaga gagaagtttc tgacgtgctg      1560
     gacaagcttg acaatttaaa gaagaaaaaa gtctacgaac attatgagaa agtcgaggtc      1620
     gcgggtggtg ccacaaaggg tgccgtcaca tcggctcctg cacgaaggga gaagccctcg      1680
     atgccttaca ctcccaacgc gagccgtcgc caagcgccgc gcacgactcc tacacctgac      1740
     ttgagtgcgc aggcaaccag cggaagcacc ttgccgcttc ggaaaccgct gtcgacaata      1800
     ccttccaaga gaggcccttc atcgcctcta aagacaggca ctcgagtgga aacttaccaa      1860
     gatggagcgt cgtccatgaa atccagactg acggcgcgtt ccttgactac tgactccgca      1920
     cctgcctcga aaccgcaggc agcgcctcat gcaggattcg aagaacttca aagacagaag      1980
     caaaagtggc ttaaagagcg ccaagaattt ttggccacca tcacagactt ccaaaacaag      2040
     gcttcgcatt tgagctcaga aaattcttct ttacgacagc agttggacac cgttcaatcc      2100
     agcttacacg aaagcaacat cgagctgcga tcaaaggaaa tgcagattac tcgtcttcaa      2160
     gatcggatat ccaacctaga gcaggagtta gaagccaagt caaccctgcc ctcttccaat      2220
     tacggcgttc ggtcggcttc ctcattcgaa cctccgtcgg cgccgctatc tttagcacca      2280
     cctgggaccc cgccaaccaa aagagttttc tcctcctcat ctaacggccg cgcttcgcca      2340
     tcgttcgacg caaattcaga taggattgca gacagccgtc taccgagcgt cggtagtaga      2400
     ctgaggtccc cgagtgaatg tagcgacgac ttgcctcata gagtaaactc cttgcagctg      2460
     cgttccgcgg agcgtgctgc cacgaccggc aatagctttt tgaatgacga aagctggaaa      2520
     agagcggctg aggtaacatc gcaactaaag gctaggatag agcgcatgag ggctaagaca      2580
     cggggtatgg gtaattcgtg a                                                2601
//

If you have problems or comments...

PBIL Back to PBIL home page